(data stored in ACNUC1104 zone)

EMBL: CP002417.PE247

CP002417.PE247       Location/Qualifiers
FT   CDS_pept        complement(263341..264327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0248"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pol:Bpro_3347 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34470"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1A6"
FT                   /inference="similar to AA sequence:KEGG:Bpro_3347"
FT                   /protein_id="ADU34470.1"
FT                   /translation="MNARKKTLAVALVALTASMLAPDAPAQTAAYPTKPVRWVVGYPAG
FT                   GGTDFLARTVGAQVSQQIGQPVLVDNKPGAGAIIASENVARAPGDGYTVFSADNGVLVY
FT                   NPALYKKLPYDAEKDFALVGMMGRSPLVITAAPNAGVADAKALIAALKASPGKFSIATP
FT                   GTGSPHHLALELFQREAGVSMLHVPYKGGAPALQDLMGGQVPLMMLDLPSGVSAVKAGK
FT                   VIPLLAMSAERIPQLPNVPTAKELGYANVEAYTWQGLVTPAATPKEVQAKLGTELQKAM
FT                   GDAGVKQKLYDAGWEARPADATEMTRYADAERKKWHALIKARDIKLD"
     atgaacgcca gaaagaaaac actcgccgtc gccctcgtgg cgctgactgc ctcgatgctc        60
     gcgcccgatg caccggcgca gacggccgcc taccccacca agcccgtgcg ctgggtggtc       120
     ggctacccgg ccggcggcgg caccgacttt ctcgcgcgca cggtcggcgc gcaggtgtcg       180
     cagcagatcg gccagccggt gctcgtcgac aacaagcccg gcgcgggcgc gatcatcgcg       240
     tcggagaacg tggcacgcgc accgggcgac ggctacacgg tgttctccgc cgacaacggg       300
     gtgctggtct acaaccccgc gctctacaag aagctgccct acgacgccga aaaagacttc       360
     gcgctcgtgg gcatgatggg ccgctcgccg ctggtcatca ccgccgcgcc caatgccggc       420
     gtggccgatg cgaaggcgct catcgccgcg ctgaaggctt cgcccggcaa gttcagcatc       480
     gcgacgcccg gcaccggcag cccgcaccat ctggcgctgg aactgttcca gcgcgaggcc       540
     ggcgtgtcga tgctgcatgt gccctacaag ggcggcgctc ctgcattgca agacctcatg       600
     ggcggccagg tgccgctgat gatgctcgac ctgcccagcg gcgtgagcgc cgtgaaggcc       660
     ggcaaggtga ttccgctgct ggcgatgtcg gccgagcgca ttccgcaact gcccaacgtg       720
     cccactgcga aggaactggg ctacgccaac gtcgaggcct acacctggca aggcctggtg       780
     acgcccgcag ccacgccgaa ggaagtgcag gccaagctcg gcaccgaact ccagaaggcc       840
     atgggcgacg ccggcgtgaa gcagaagctc tacgacgccg gctgggaagc acgtcccgct       900
     gatgccaccg aaatgacgcg ctacgccgat gcggagcgca agaaatggca tgccttgatc       960
     aaggcgcgcg acatcaagct cgactga                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page