(data stored in SCRATCH zone)

EMBL: CP002417.PE248

CP002417.PE248       Location/Qualifiers
FT   CDS_pept        complement(264371..265141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0249"
FT                   /product="4-hydroxyphenylacetate degradation bifunctional
FT                   isomerase/decarboxylase,HpaG2 subunit"
FT                   /note="KEGG: vap:Vapar_0244 4-hydroxyphenylacetate
FT                   degradation bifunctional isomerase/decarboxylase,HpaG2
FT                   subunit; TIGRFAM: 4-hydroxyphenylacetate degradation
FT                   bifunctional isomerase/decarboxylase,HpaG2 subunit; PFAM:
FT                   fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34471"
FT                   /db_xref="GOA:E6V1A7"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR012684"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1A7"
FT                   /inference="protein motif:TFAM:TIGR02303"
FT                   /protein_id="ADU34471.1"
FT                   /translation="MKHARVIHEGREHTGIAHEFNGQPDAAVRLEDGRVVPQEQLTWLP
FT                   PLAPTARPRTILALGLNYADHAKELEFKAPEEPLVFVKGQSTLIGHRQLTHRPAGVQFM
FT                   HYECELAIVVGKTARHVKRDDAYDFIGGYTVANDYAIRDYLENWYRPNLRVKNRDTCTP
FT                   LGPWFVDAADVSDPMALALRTTVNGTVTQQGNTRDMIFDAPFLIEYFSRFMTLSPGDLI
FT                   LTGTPDGVVDCEPGDVIVTDIEHIGALINTIDAA"
     atgaagcacg cacgcgtcat ccacgaaggc cgcgagcaca ccggcatcgc gcacgaattc        60
     aacggccagc cagacgccgc cgtgcgtctc gaagacggcc gcgtcgttcc gcaagagcag       120
     ctcacctggc tcccaccgct cgcgcctacc gcacggccgc gcaccatcct cgcgctcggc       180
     ctcaactacg ccgaccacgc gaaggagctc gagttcaagg cgcccgagga accgctggtc       240
     ttcgtcaagg gccagagcac gctgatcggt caccgccagc tcacgcaccg ccccgccggc       300
     gtgcagttca tgcactacga atgcgagctc gccatcgtcg tcggcaagac cgcgcgccat       360
     gtgaagcgcg acgacgccta cgacttcatc ggcggctaca cggtggccaa cgactacgcg       420
     atccgcgatt acctggagaa ctggtatcgc ccgaacctgc gtgtgaagaa ccgcgacacc       480
     tgcacgccgc tcggcccctg gttcgtcgat gcggccgatg tatccgaccc gatggcgctt       540
     gcgctgcgca ccaccgtcaa cggcaccgtc acgcagcagg gcaacacgcg cgacatgatc       600
     ttcgatgcgc cctttctcat cgagtacttc agccgtttca tgacgctctc gccgggcgac       660
     ctgatcctca cgggcacacc cgacggcgtg gtcgactgcg agccgggcga tgtgatcgtc       720
     accgacatcg agcacatcgg cgcgctgatc aacacgatcg acgcggcctg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page