(data stored in ACNUC1104 zone)

EMBL: CP002417.PE257

CP002417.PE257       Location/Qualifiers
FT   CDS_pept        complement(272642..273643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0258"
FT                   /product="exonuclease RdgC"
FT                   /note="PFAM: exonuclease RdgC; KEGG: vap:Vapar_0253
FT                   recombination associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34480"
FT                   /db_xref="GOA:E6V1B6"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1B6"
FT                   /inference="protein motif:PFAM:PF04381"
FT                   /protein_id="ADU34480.1"
FT                   /translation="MSVFKNVIVYRIEPAWSQTLAEAEEGLGKHRFEPCGPSQEKSAGW
FT                   AEPRGEAGGPLVESIDGQWLVEYMIESKQVPGSVVRRKLDERCAQIEATTGRKPGKKEK
FT                   KELKEDITLELLPMAFTRSARVAVWIDKAEHRLVINSGNASRADEVVTSLVKSLDGFAV
FT                   ALINTQIEPAAAMANWLLTQEPPAGFTIDRECELKASDDSKAVVRYAKHPLDIEEVQKH
FT                   ITDGKRPTRLALTWDDRVSFELTHGMLIRKIVFLEGTGDGAAGGKKEDNYDADVAIATG
FT                   ELGQLVPALLDALGGEAAFGAAPADEAPKPAAKAAVPTTPVDAAEEEEDAPF"
     gtgtccgtat tcaagaacgt catcgtctat cgcatcgaac ctgcctggtc ccaaacattg        60
     gccgaggcgg aagagggctt gggcaagcac cgcttcgagc cctgcggccc ctcgcaggaa       120
     aagtctgccg gctgggccga gccccgcggc gaggccggcg gcccgttggt cgaatccatc       180
     gacggccagt ggctcgtcga atacatgatc gagagcaagc aggtccccgg ctccgtggtg       240
     cgccgcaagc tcgacgagcg ctgcgcgcag atcgaggcca ccaccggccg aaagcccggc       300
     aagaaggaaa agaaggagct caaggaagac atcaccctgg agctgctgcc gatggccttc       360
     acccgcagcg cgcgcgtggc ggtgtggatc gacaaggccg agcaccgcct cgtgatcaac       420
     agcggcaacg cctcgcgcgc cgacgaagtg gtcaccagcc tcgtgaagtc gctcgacggc       480
     tttgcggtgg cactgatcaa cacgcagatc gaaccggccg ccgccatggc gaactggctg       540
     ctgacgcagg agccgccggc cggcttcacc atcgaccgcg agtgcgaact caaggcctcg       600
     gacgattcga aggccgtggt gcgctacgcc aagcacccgc tcgatatcga ggaagtgcag       660
     aagcacatca ccgacggcaa gcggcccact cgcctcgcgc tcacctggga cgaccgcgtg       720
     tcgttcgagc tgacgcacgg catgctgatc cgcaagatcg tgttcctgga aggcacgggc       780
     gacggcgcgg caggcggcaa gaaggaagac aactacgacg ccgacgtggc aatcgccacc       840
     ggcgaacttg gccaactggt gccggcgctg ctcgatgcgc tgggcggcga ggcggcgttc       900
     ggcgcggcac cggcggacga agcgccgaag ccggccgcca aagcggcagt gcccacgacc       960
     ccggtcgatg ccgccgagga agaggaagac gcgccgtttt aa                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page