(data stored in SCRATCH zone)

EMBL: CP002417.PE258

CP002417.PE258       Location/Qualifiers
FT   CDS_pept        274043..274996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0259"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /note="KEGG: vap:Vapar_0254 branched-chain amino acid
FT                   aminotransferase; TIGRFAM: branched-chain amino acid
FT                   aminotransferase; PFAM: aminotransferase class IV"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34481"
FT                   /db_xref="GOA:E6V1B7"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1B7"
FT                   /inference="protein motif:TFAM:TIGR01122"
FT                   /protein_id="ADU34481.1"
FT                   /translation="MSSIPPSLDDRDGKIWMDGELVDWRDAKIHVLSHTLHYGCGAFEG
FT                   VRAYKTADGGTSIFRLAEHTERLFNSAKILRMKIPFSQEQLNEAQKQVVRENKLESCYL
FT                   RPLIWIGSEKLGVSPKGNKIHAMVAAWSWGAYLGEEGMRRGIRVKTSSYTRHHVNITMT
FT                   QAKSVSNYTNSILANMEALDDGYDEALLLDASGFVSEGAGENIFVVKGGVVYTPDLSAG
FT                   ALNGITRNTILHICKDLGLELVQKRITRDEVYISDEAFFTGTAAEVTPIRELDRIEIGN
FT                   RGDGGSRGPITEKIQSAFFDIVNGKNPKYAHWLTKV"
     atgagctcga tccccccctc gctggacgac cgtgacggca agatctggat ggacggcgaa        60
     ctcgtggact ggcgcgacgc caagatccac gtgttgagcc acacgctgca ctacggatgc       120
     ggcgccttcg agggcgtgcg cgcctacaag acggcggacg gcggcacctc catcttccgc       180
     ctggccgagc acaccgagcg cctgttcaac agcgccaaga tcctgcgcat gaagattccc       240
     ttctcgcagg agcaactgaa cgaagcccag aagcaggtgg ttcgcgagaa caagctggaa       300
     agctgctacc tgcgccccct catctggatc ggctccgaaa agctgggcgt gagccccaag       360
     ggcaacaaga tccacgccat ggtcgcggcc tggtcctggg gcgcctacct cggcgaagaa       420
     ggcatgcgcc gcggcatccg cgtgaagacc tccagctaca cccgccacca cgtcaacatc       480
     acgatgacgc aggccaagtc ggtgagcaac tacacgaatt cgatcctggc caacatggaa       540
     gcgctggacg acggctacga cgaagcgctg ctgctcgatg cgagcggctt cgtgtcggaa       600
     ggcgcgggcg agaacatctt cgtggtcaag ggcggcgtgg tctacacgcc tgacctctcg       660
     gccggcgccc tgaacggcat cacgcgcaac acgatcctgc acatctgcaa ggacttgggg       720
     ttggaactcg tgcagaagcg catcacgcgc gacgaggtct acatctccga cgaagccttc       780
     ttcaccggca ccgccgccga agtgacgccg atccgcgaac tcgaccgcat cgagatcggc       840
     aaccgtggcg acggcggctc gcgcggcccg atcaccgaga agatccagtc tgccttcttc       900
     gacatcgtga acggcaagaa tcccaagtac gcccactggc tcacgaaagt ctga             954
//

If you have problems or comments...

PBIL Back to PBIL home page