(data stored in SCRATCH zone)

EMBL: CP002417.PE261

CP002417.PE261       Location/Qualifiers
FT   CDS_pept        complement(275650..276705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0262"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pmy:Pmen_4463 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34484"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1C0"
FT                   /inference="similar to AA sequence:KEGG:Pmen_4463"
FT                   /protein_id="ADU34484.1"
FT                   /translation="MRRILATLILLLACTFGAHAAPAVVQGLVHGSGPEAQRFPWVRTD
FT                   DAKVADRINQFLFIDTFEAMAPARAAEGLRGVDAKNWERLPNLGYAVLRNDGRVLSLRV
FT                   EGEGCGAYCESFSVGHAFDATTGRHLSPGDLFTAEGLADMARKIQANNAARLRKEIAAL
FT                   GNKARSKEEAREDKIALYTECLTSRQDPVYQKIEGMRGMEIDAKGVLFTQGRCSNHAMR
FT                   ALDDLDDLSTRFTPAQLGPWLTAYGRALLLGEGAAPAPASPFDQVLHGTIDARLPVTLR
FT                   LEALRSDGSVAATYFYDRYRKAISVFGKYQNGVLLLEESSDTRLRLKPDGAGLRGEWIS
FT                   GQKTLPMVLAP"
     atgcgacgca tcctcgccac cctcatcctg cttctggcct gcaccttcgg tgcgcacgcg        60
     gcccccgccg tcgtgcaggg cctcgtccac ggctcaggcc ccgaggcgca acgctttccc       120
     tgggtgcgca ccgacgacgc caaggtcgcc gatcgcatca accagtttct tttcatcgac       180
     accttcgagg ccatggcgcc ggcgcgcgcc gcggagggcc tgcgcggcgt cgatgcgaaa       240
     aactgggagc ggttgccgaa cctcggctac gcggtgctgc gcaacgacgg ccgcgtgctg       300
     tcgctgcgcg tcgaagggga aggctgcggc gcgtattgcg aaagcttctc cgtcgggcac       360
     gcgttcgatg cgacgaccgg gcgtcatctc tcgccgggcg acctgttcac cgccgagggc       420
     cttgccgaca tggcgcgcaa gatccaggcg aacaacgccg ccaggctgcg caaggagatt       480
     gccgcgctgg ggaacaaggc gcgcagcaag gaagaagcgc gcgaagacaa gatcgcgctc       540
     tacaccgagt gcctgacgtc gcgccaggac ccggtctacc agaagatcga gggcatgcgc       600
     ggcatggaga tcgatgcgaa gggcgtgctg ttcacgcagg gccgctgcag caaccacgcg       660
     atgcgcgcgc tggacgacct cgatgacctc agcacccgct tcacgcccgc ccagctcggg       720
     ccgtggctca cggcttacgg ccgcgcgctg ctgctgggcg aaggcgcggc gcctgctccg       780
     gcatcgccgt tcgaccaggt gttgcacggc accatcgatg cgcgcctgcc ggtgaccctg       840
     cggctggagg cgctgcgcag cgacggctct gtcgccgcca cgtatttcta cgaccgctat       900
     cgcaaagcga tctcggtgtt cggcaaatac cagaacggcg tgctgctgct cgaggagtcc       960
     agcgacacgc gcctgcgcct caagcccgat ggcgccggcc tgcgcggcga atggatcagc      1020
     ggccagaaga cgttgccgat ggtcctcgcg ccctga                                1056
//

If you have problems or comments...

PBIL Back to PBIL home page