(data stored in SCRATCH zone)

EMBL: CP002417.PE262

CP002417.PE262       Location/Qualifiers
FT   CDS_pept        complement(276710..277927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0263"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: O-antigen polymerase; KEGG: vap:Vapar_0257
FT                   O-antigen polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34485"
FT                   /db_xref="GOA:E6V1C1"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1C1"
FT                   /inference="protein motif:PFAM:PF04932"
FT                   /protein_id="ADU34485.1"
FT                   /translation="MFWGLVVFMPVGVTYLSAILLLLAMLLAGGYAERFARLRANPLWW
FT                   PVVAYLAWTLLVLAFGPHYPETGSNLFHGVRIGLTILMAMALTREEAIWALRGFLLIAA
FT                   LNILLIVLHYAIGFPVWSPLRGVVMEVGNKSISNALLFSVVAATAAVWGIAQTAGHKPL
FT                   RAIPAFLLMLGLGFVVALPLTSRTSVLALLLVVPVVCIHQWRNHLKMLVSALVLGAVVI
FT                   GAALYQLPQLQHKVETGVQEIEEAQTGAVFHGSWVIRYYMYRDTGLMIADRPLTGWGIG
FT                   GWTSQWHKRGPALFADSNMPHNDFLWVGAQGGLPALLSLLVIMVAAVWQAWRRPDIAGR
FT                   FALAATLIALIASSVNSAMRDAQIGLALLWIAMVYLRLAQEKNDPAPWRDLWPWRRPNL
FT                   NTNPTA"
     atgttctggg ggctggtggt gttcatgccg gtcggcgtca cctacctgtc ggccatcctg        60
     ttgctgctcg cgatgctgct cgccggcgga tacgccgaac gcttcgcgcg cctgcgcgcc       120
     aatccgctgt ggtggccggt ggtcgcctac ctggcctgga cccttctggt gctggccttc       180
     gggccgcact acccggagac cggctccaac ctctttcacg gcgtgcgcat cggcctcacg       240
     atcctgatgg cgatggcgct cacgcgcgaa gaagcgatct gggcgttgcg cggcttcctg       300
     ctgatcgcgg cgctgaacat cctgctgatc gttctgcact acgccatcgg ctttccggtc       360
     tggtcgccgc tgcgcggggt ggtcatggag gtgggcaaca agtcgatcag caacgcgctg       420
     ctgttcagcg tggtggccgc cacggctgcc gtgtggggca ttgcgcagac cgccggtcac       480
     aagccgctgc gcgccattcc ggctttcttg ctgatgctgg ggctgggctt cgtggtcgcg       540
     ctgccgctga cctcgcgcac ctcggtgctc gcgctgctgc tggtggttcc ggtggtgtgc       600
     atccaccagt ggcgcaacca tctgaagatg ctggtgagcg cgctggtgct gggagcggtc       660
     gtgatcgggg ccgcgctcta tcagttgccg cagctgcagc acaaggtcga gacgggcgtg       720
     caggaaatcg aggaggcgca aaccggcgcg gtcttccacg gaagctgggt catccggtac       780
     tacatgtacc gcgacaccgg cctcatgatc gccgaccggc cgctcaccgg ctggggcatc       840
     ggcggctgga ccagccagtg gcacaagcgc ggcccggcct tgttcgcgga ctcgaacatg       900
     ccgcacaacg actttctctg ggtgggcgcg cagggcggat tgcccgcgct gctgagcctg       960
     ctggtcatca tggtggcggc ggtatggcag gcgtggcggc gtcccgacat cgccggccgc      1020
     ttcgcattgg ccgcaacgct gatcgcgctg atcgcatcga gcgtgaactc ggccatgcgc      1080
     gatgcgcaga tcggcctcgc gctgctctgg atcgcgatgg tgtatctgag gctcgcgcag      1140
     gaaaagaacg atcccgcgcc gtggcgcgac ctgtggccgt ggcgtcggcc gaacctgaac      1200
     accaatccca cggcataa                                                    1218
//

If you have problems or comments...

PBIL Back to PBIL home page