(data stored in SCRATCH zone)

EMBL: CP002417.PE265

CP002417.PE265       Location/Qualifiers
FT   CDS_pept        complement(280087..281736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0266"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; KEGG: vap:Vapar_0260
FT                   monooxygenase FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34488"
FT                   /db_xref="InterPro:IPR006905"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1C4"
FT                   /inference="protein motif:PFAM:PF00890"
FT                   /protein_id="ADU34488.1"
FT                   /translation="MTDTALDSFDAVIMGGGLAGLTLAIQLKQRFGDLKVLVLERRTHP
FT                   VPHAAHKVGESSVEIGAHYFDTVLGLKAHMDEAQLRKFGFRFFFSEGRSDIDNVTEIGA
FT                   SRYLAVPSYQIDRGIFENFLAEEAVRHGVRFVDSALVRRIDLAADPATPHRIEWTRGEE
FT                   THATEARWLIDACGRAGMLKRKLGLAEPNAHDVNAVWFRIGERIAVDDWSDNAEWRERC
FT                   NPQARWLSTNHFVGAGYWAWLIPLASGSHSVGIVADPALHPLDTIDTFEKAMAWFATYQ
FT                   PRLYEALDGKRHLLQDFAFLRHFSHGCKQVFSGERWAMTGEAGLFLDPFYSPGSDFIAI
FT                   ANTYITDLIAQDRAGRPLEARAQLYDQIYHSFYESTLALYQDQYPLFGDPEVLPVKVIW
FT                   DYAYYWGVLAQIFFQRRLTDLPALGSLKDELQHCQRLNVAVQRLMRDWSASSNKSNPAA
FT                   MLDQAAMPWFAELNRSLKDTLDDAGFKDRIRASTVMLRQLAGEILGRARTADPDVEAGA
FT                   LLALLEENRGKTPATTARDAMLFAAPPVDTHA"
     atgaccgaca ctgcgctgga ttcgtttgac gcagtgatca tgggaggcgg tctcgccggc        60
     ctcacgctgg cgatccagct gaagcagcgc ttcggcgacc tgaaggtgct ggtgctggag       120
     cgccgcacgc atccggtgcc gcacgcggcc cacaaggtgg gcgaatcgtc ggtcgagatc       180
     ggggcgcact acttcgacac ggtgctcggg ctcaaggcgc acatggacga agcgcagctg       240
     cgcaagttcg gctttcgctt cttcttcagc gaaggccgca gcgacatcga caacgtcacc       300
     gagatcggcg cgagccgcta cctggcggtg cccagctacc agatcgaccg cggcatcttc       360
     gagaacttcc tggccgagga agccgtgcgg cacggcgtgc gcttcgtcga cagcgcgttg       420
     gtgcggcgca tcgatttggc cgcagacccc gcgacgcccc accgcatcga atggacgcgc       480
     ggcgaagaaa cccacgccac agaggcgcgc tggctcatcg acgcctgcgg ccgcgccggc       540
     atgctcaagc gcaagctcgg ccttgccgag cccaacgcgc acgacgtcaa cgcggtgtgg       600
     ttccgcatcg gcgagcgcat cgcggtcgac gactggagcg acaacgccga atggcgcgaa       660
     cgctgcaacc cgcaggcgcg ttggctctcg accaaccact tcgtgggcgc cggctactgg       720
     gcctggctga ttccgctggc ctcgggctcg cactcggtgg gcatcgtggc cgacccggcg       780
     ctgcatccgc tggacaccat cgacaccttc gagaaggcga tggcctggtt cgccacctac       840
     cagccgcgcc tgtacgaggc gctggacggc aagcgccacc tgctgcagga cttcgcgttc       900
     ctcaggcact tctcgcacgg ctgcaagcag gtgttctcgg gcgagcgctg ggcgatgacg       960
     ggcgaggcgg ggctctttct cgacccgttc tattcgcccg gcagcgactt catcgcgatc      1020
     gccaacacct acatcaccga cctcattgcg caggaccgcg cgggccgccc cctggaagcc      1080
     cgagcccagc tctacgacca gatctaccac tcgttctacg aaagcacgct cgcgctctac      1140
     caggaccagt acccgctctt cggtgacccg gaggtgctgc cggtgaaggt gatctgggac      1200
     tacgcgtact actggggcgt gctcgcgcag atcttcttcc agcggcgcct gaccgacctg      1260
     ccggcgctcg gaagcctgaa ggacgaactg cagcactgcc agcgcctgaa tgtcgcggtg      1320
     cagcggctga tgcgcgactg gtcggcgtcg agcaacaaga gcaacccggc cgcgatgctc      1380
     gaccaggccg cgatgccgtg gttcgccgag ctcaaccgca gcctgaagga cacgctcgac      1440
     gacgccggct tcaaggaccg catccgggct tcgacggtca tgctgcggca actggccggc      1500
     gaaatcctcg ggcgggctcg caccgccgat ccggacgtgg aggccggcgc cctgctggcg      1560
     cttctcgaag aaaaccgtgg gaaaacaccc gcgaccacgg cccgcgacgc tatgcttttc      1620
     gcagcacctc cggttgacac ccacgcctga                                       1650
//

If you have problems or comments...

PBIL Back to PBIL home page