(data stored in ACNUC1104 zone)

EMBL: CP002417.PE266

CP002417.PE266       Location/Qualifiers
FT   CDS_pept        complement(281741..282622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0267"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0261 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34489"
FT                   /db_xref="GOA:E6V1C5"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1C5"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0261"
FT                   /protein_id="ADU34489.1"
FT                   /translation="MSTTATPPTPPMPPMPPTLYIEGPAFWTPTLPGWDAARAAFRGEG
FT                   ALADPPAKRPSPQVLAPAERRRAPDTVALALEVAAAAMAASGRNAADVPCVFASAHGDL
FT                   SINDYMCGTLASDPKMLSPTKFHNSVHNAAVGYWTIGTGCMAASNAVSAYENSFASGLL
FT                   EAAVQCAADQEPVLLVGYDTPTVGALTSVTESRGMLAVAMVIAPVRTERSVAALQWSLA
FT                   SHGAAGDDAAATYTPLRSEAAKSLVAINPMAQALGLFESLAHVEGEDEPAFGLQLSPTL
FT                   SLRLQLRPPPKD"
     atgagcacga cagcgacgcc cccgacgccc ccgatgcccc cgatgccccc caccctctac        60
     atcgaaggcc cggccttctg gacgccgacc ctccccggct gggacgccgc gcgcgcggcc       120
     ttccgcggcg aaggtgcgct ggccgatccg ccggccaagc ggccctcgcc gcaggtgctg       180
     gccccggccg agcgccgccg tgcgcccgac accgtggcgc tggcgctcga agtggccgcc       240
     gccgccatgg ccgcctcggg ccgcaacgcg gccgacgtgc cctgcgtgtt cgcctcggcg       300
     cacggcgacc tgtcgatcaa cgactacatg tgcggcacgc tcgcgagcga tccgaagatg       360
     ctttcgccca ccaagttcca caactccgtg cacaacgcgg ccgtggggta ctggaccatc       420
     ggcacgggct gcatggcggc gagcaatgcc gtgtcggcct atgaaaacag cttcgcctcc       480
     ggcctgctcg aagcggccgt gcaatgcgcg gccgaccagg agccggtgct gctggtgggc       540
     tacgacacgc ccaccgtcgg cgccctgaca tcggtgaccg aaagccgcgg catgctcgcg       600
     gtggcgatgg tgatcgcgcc cgtgcgcacc gagcgcagcg tggccgcgct gcagtggtcg       660
     ctggcctccc acggtgcggc gggcgacgac gcggcggcca cctacacgcc gctgcgatcg       720
     gaagccgcaa agtcgctggt ggccatcaac ccgatggcgc aggcgctcgg cctgttcgaa       780
     tcgctggcgc acgtcgaagg cgaggacgaa ccggcgttcg gcctgcagct ctcgcccacc       840
     ctgtcactca ggctgcagct gcggcctcct ccgaaggact ga                          882
//

If you have problems or comments...

PBIL Back to PBIL home page