(data stored in ACNUC1104 zone)

EMBL: CP002417.PE268

CP002417.PE268       Location/Qualifiers
FT   CDS_pept        complement(283973..285358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0269"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   vap:Vapar_0263 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34491"
FT                   /db_xref="GOA:E6V1C7"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1C7"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADU34491.1"
FT                   /translation="MDNPGLMSAPPLETPTTPSPSWRDTLKVYLEPATLRMLALGFSAG
FT                   LPLLLVLGTLSFRLREAGIDRTTIGYLSWVGLAYGFKWVWAPLVDRMPLPPLTTLLGRR
FT                   RGWLLLAQALVIVGLVGMAMNDPRNGLAPLVWCALLVAFGSATQDIALDAFRIESAETR
FT                   KQAALAAAYQTGYRLAMIWAGAGVLWVAAWAEVAPAVAATGAAAYQNGAWKTAYLVMAA
FT                   SMGVGVLTVLLSPEPVRLVLPKAKNAAEWLQNVLIDPFADFIRRYKWQAALILALIAIY
FT                   RISDVVMGIMANPFYVDMGFTKDEVATVSKIYGVVMTLVGAFVGGVLSMRLGVMRVLML
FT                   GAVLSAASNLLFAWLASRGHDLTALIAVVSADNLAGGIASAAFIAYLSSLTNISYSATQ
FT                   YALFSSLMLLLPKFIAGYSGAFVDAYGYSQFFTATALLGVPVLLLVALASRLTTTTSAA
FT                   DRQ"
     atggacaatc cggggctcat gtccgctccg ccgctcgaaa cccccaccac cccctcaccg        60
     tcctggcgcg acacgctgaa ggtctacctc gagccggcca cgctgcgcat gctggcgctg       120
     ggcttctcgg ccgggctgcc gctgttgctg gtgctgggca cgctgagctt tcgcctgcgc       180
     gaagcgggca tcgaccgcac caccatcggc tatctgagct gggtgggcct ggcctacggc       240
     ttcaagtggg tctgggcgcc gctggtcgac cggatgccgc tgccgccgct gaccacgctg       300
     ctcgggcggc gccgcggctg gctgctgctg gcgcaggcgc tggtgatcgt cgggctggtc       360
     ggcatggcga tgaacgatcc gcgcaacggg ctcgcgccgc tggtctggtg cgcgctgctg       420
     gtggccttcg gctcggccac gcaggacatc gcgctggacg cgttccgcat cgaatcggcc       480
     gagacgcgca agcaagccgc gctcgccgcc gcgtatcaaa cgggctaccg gctcgcgatg       540
     atctgggccg gcgccggcgt gctgtgggtc gcggcctggg ccgaggtggc gcccgccgtc       600
     gccgccaccg gcgcggcggc ctaccagaac ggcgcctgga aaaccgccta cctcgtgatg       660
     gccgcctcga tgggcgtcgg cgtgctcacg gtgctgctgt cgcccgagcc ggtacggctc       720
     gtgctgccca aggcgaagaa cgcggccgag tggctgcaga acgtgctgat cgatcccttt       780
     gccgatttca tccgccgcta caagtggcag gccgcgctga tcctcgcgct gatcgccatc       840
     taccgcatca gcgacgtggt gatgggcatc atggccaacc cgttctacgt ggacatgggc       900
     ttcaccaagg acgaggtggc cacggtcagc aagatatacg gcgtggtcat gacgctggtg       960
     ggcgccttcg tgggcggcgt gctctcgatg cgcctgggcg tgatgcgcgt gctgatgctg      1020
     ggcgcggtgc tcagtgccgc gagcaacctg ctgttcgcct ggctggcctc gcgcgggcac      1080
     gacctcacag cactcatcgc ggtggtctcg gccgacaacc tggccggcgg catcgcctcg      1140
     gcggccttca tcgcctacct gtcgagcctg accaacatca gctactcggc gacgcagtac      1200
     gccctgttca gctcgctgat gctgctgctg cccaaattca ttgccggcta ctcgggcgcc      1260
     ttcgtcgacg cctacggcta cagccagttc ttcaccgcca ccgcgctgct gggcgtgccg      1320
     gtgctgctcc tggtcgcgct ggcctcgcgc ctcacgacga ccacaagcgc cgccgaccgt      1380
     caatag                                                                 1386
//

If you have problems or comments...

PBIL Back to PBIL home page