(data stored in ACNUC1104 zone)

EMBL: CP002417.PE269

CP002417.PE269       Location/Qualifiers
FT   CDS_pept        285419..286291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0270"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: vap:Vapar_0264
FT                   peptidase M48 Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34492"
FT                   /db_xref="GOA:E6V1C8"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1C8"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ADU34492.1"
FT                   /translation="MCTRCERPISAASAASPASPWQPRRAFLLAAAGAATTALGGPAFA
FT                   QVNVGNASVARNLVPADKIEAAGVQQYGQLLAQARAKNALAGDNNAQLQRLRAIAQRLI
FT                   PFATPWNTRAREWKWEVNLIGSKQINAFCMPGGKIAFFTGILEQLKLSDDEVAMVMGHE
FT                   MAHALREHARARMAKSAGTGAALSIGAQLLGLGQVGDIAARAGTQLITLKFSRSDETEA
FT                   DLVGLELAARAGYDPKASVSLWNKMATASKNQGGLSFLSTHPSGTDRIAKLEANIPKVE
FT                   SLYRNAKRS"
     atgtgcacac gatgcgaacg ccccatttcc gccgcctcgg ccgcttcccc ggcctcgccc        60
     tggcagccgc gaagagcctt cctgctggcc gcggccggtg cggccaccac ggcgctcggc       120
     ggtccggcct tcgcgcaggt caacgtcggc aacgcctcgg tggcgcgcaa cctcgtgccc       180
     gcggacaaga tcgaggcggc cggcgtccag cagtacggcc agttgcttgc ccaagcccgc       240
     gccaagaacg cgctcgccgg cgacaacaac gcgcaactgc agcggctgcg tgccatcgcg       300
     caacggctca ttccctttgc cacgccctgg aacacgcggg cgcgcgaatg gaagtgggag       360
     gtcaacctga tcggcagcaa gcagatcaac gccttctgca tgcccggcgg caagatcgct       420
     ttcttcaccg gcatcctcga gcagctcaag ctgagcgacg acgaggtcgc gatggtgatg       480
     ggccacgaga tggcccacgc gctgcgcgaa cacgcccgcg cccgcatggc caagagcgcc       540
     ggcaccggtg cggcgctgtc gatcggcgcg cagctgctgg gcctcgggca ggtgggcgac       600
     atcgcggcgc gcgccggcac gcagctcatc acgctcaagt tcagccgcag cgacgagacc       660
     gaggccgacc tcgtggggct cgaactcgcg gcacgcgcgg gctacgaccc gaaggcttcg       720
     gtgtcgctgt ggaacaagat ggcgaccgct tcgaagaacc aaggcggctt gagctttctc       780
     tcgacgcacc cgagcgggac ggaccggatt gcgaagctcg aagcgaacat cccgaaggtg       840
     gagagcctct accggaacgc caagcggagc tga                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page