(data stored in ACNUC1104 zone)

EMBL: CP002417.PE270

CP002417.PE270       Location/Qualifiers
FT   CDS_pept        286517..288232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0271"
FT                   /product="allophanate hydrolase"
FT                   /note="KEGG: vap:Vapar_0265 allophanate hydrolase; TIGRFAM:
FT                   allophanate hydrolase; PFAM: Amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34493"
FT                   /db_xref="GOA:E6V1C9"
FT                   /db_xref="InterPro:IPR014085"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1C9"
FT                   /inference="protein motif:TFAM:TIGR02713"
FT                   /protein_id="ADU34493.1"
FT                   /translation="MVHEYDPLTAAAWIAKFPTPVAGAETADTPGVTLPLAGLRFAVKD
FT                   NIDVAGVPTTAACPAFDRRPTAHAAVVQRLLEAGASLAGKTNLDQFACGLNGTRSPYGE
FT                   VPNAFDARYVSGGSSSGSAYVVAAGEVDFALGTDTAGSGRVPAGLNNIVGLKPSRGLLS
FT                   TFGVVPAAQSADCVSIFARTVALAVDVMLAASGHDPRDPYSRDIAMHRKPLPARFNFGV
FT                   PDTLSFFGDTVAEEAFRDAQAKLVALGGTAVTIPYAPLAEAAALLYESALVAERYAAVR
FT                   EFFDAHADEVIEPVRSILASGKKYVAADVFDAQTRLRAIAQQVEPMWRDIDVLLVPTAP
FT                   THYTREAMRADPVVLNRNLGAYTNFVNLLDYAALSVPSSLRADGLPFGITLIGPSGSDL
FT                   ALADLGQRYHHATGLAQGATGQPLPAPRPVPGLMAPVPQTLAIAVVGAHLSGMPLNGQL
FT                   TERGATLLRATTTSPAYRLFALPGTTPPKPGLQRSAEGGAAIALEVWAVPIAQVGSFLA
FT                   LIPPPLGLGSVELADGSWVHGFICEGHALADGQDVTHHGGWRAYVASRATTPSN"
     atggtgcatg aatacgaccc gctgaccgcc gccgcctgga tcgcgaaatt cccgacgccc        60
     gtggccggtg ccgaaactgc cgacaccccc ggcgtgaccc tgccgctcgc cgggctgcgc       120
     ttcgcggtca aggacaacat cgacgtggcc ggcgtgccca ccaccgccgc ctgcccggcc       180
     ttcgaccgcc gcccgacggc acacgcggcc gtggtgcagc ggctgctcga agccggtgcg       240
     tcgctggccg gcaagaccaa tctcgaccag ttcgcctgcg gcctgaacgg cacgcgctcg       300
     ccgtatggcg aggtgcccaa cgccttcgat gcgcgctacg tttccggcgg ttccagctcc       360
     ggttcggcgt acgtggtggc tgcgggcgag gtcgacttcg cgctcggcac cgacaccgcc       420
     ggctccggcc gcgtgcccgc cgggctcaac aacatcgtcg gcctcaagcc ttcgcgcggg       480
     ctgctcagca ccttcggcgt ggtgccggct gcgcagagcg cggactgcgt ttcgatcttc       540
     gcgcgcaccg tggcgctggc cgtcgacgtg atgctcgccg cctccggcca cgacccgcgc       600
     gacccgtact cgcgcgacat cgcgatgcac cgcaagccgc tgcccgcacg cttcaacttc       660
     ggcgtgcccg acacgctgag cttcttcggc gacaccgtgg ccgaagaagc cttccgcgat       720
     gcgcaggcca agctcgtggc attgggcggc acggccgtca ccattcccta cgcgccgctc       780
     gccgaggccg cagcactgct ttatgaaagc gcactcgtcg ccgaacgcta cgccgccgtg       840
     cgcgagttct tcgacgcgca tgccgacgag gtgatcgagc ccgtgcgcag catcctcgcg       900
     agcggaaaga aatatgtcgc cgccgacgtg ttcgacgcgc agacccgcct tcgcgccatc       960
     gcgcaacagg tcgagccgat gtggcgcgac atcgacgtgc tgctggtgcc caccgcgccc      1020
     acgcactaca cgcgcgaagc catgcgcgcc gacccggtcg tgctcaaccg caacctcggc      1080
     gcgtacacca acttcgtcaa cttgctcgac tacgcggccc tttctgtgcc gagcagcctg      1140
     cgtgcggacg gcctgccgtt cggcatcacg ctgatcggcc cgagcgggag cgatctcgca      1200
     ctggccgacc tcggccagcg ctatcaccac gcgaccggcc ttgcgcaagg cgcgaccggc      1260
     cagccgctgc ccgcaccgcg cccggtgccg ggcctcatgg caccggtgcc gcagacgctc      1320
     gccatcgccg tggtcggcgc gcatctgtcg ggcatgccgc tcaatggcca gctcaccgag      1380
     cgcggcgcca cgctgctgcg cgccacgacc acatcgccgg cctaccgcct cttcgcactc      1440
     cccggcacca cgccgcccaa gcccggcctg caacgcagcg cggaaggcgg cgccgccatc      1500
     gcgctcgaag tgtgggccgt gcccatcgcg caggtcggca gcttcctcgc gctgatcccg      1560
     ccgccgctcg gcctcggcag cgtcgagctg gccgacggca gctgggtcca cggcttcatc      1620
     tgcgaaggcc atgcgctggc cgacgggcag gacgtgaccc accacggcgg ctggcgcgct      1680
     tacgtcgcga gccgcgccac caccccttcc aactga                                1716
//

If you have problems or comments...

PBIL Back to PBIL home page