(data stored in ACNUC1104 zone)

EMBL: CP002417.PE271

CP002417.PE271       Location/Qualifiers
FT   CDS_pept        288254..289258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0272"
FT                   /product="NMT1/THI5 like domain protein"
FT                   /note="KEGG: vap:Vapar_0266 NMT1/THI5 like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34494"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1D0"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0266"
FT                   /protein_id="ADU34494.1"
FT                   /translation="MSTFDKSSASRRQLLQAGIGAAGLAVLAAPAIVRAQAAPKLRIGY
FT                   WPVAAGLPFFAAVDRGYFKEAGLDVEPLKFAAAQQIMEGMLAGRCDGSANGTGSANLAI
FT                   GEIAQPGLFKIFCTNPSNAKFVLDEFIVAKDSPVKTVAELAGKKVASGPGIQNVTLCKT
FT                   MLERAGAKGAVVSELPIGQHVAALAAGQVDACYTLEPTGTVGRMNGTTRVIEAGVVARY
FT                   ILGDPMAPWHGGAASLTSEFIKKNPEVAKKYIAAYARGVELVRTKPDDARQHMKGYTAI
FT                   EGKLTAEVPLASYMLYNEFKPSDVAYFQKFYDLFTEKGIFEKKVPVDALLYKA"
     atgagcacct tcgacaaatc ttccgcctcg cgccggcagt tgctgcaggc cggcatcggt        60
     gcagcgggcc tggccgtgct ggccgcgccc gccatcgtgc gtgcacaggc cgcgcccaag       120
     ctgcgcatcg gctactggcc cgtggccgcc ggcctgccgt tcttcgcggc ggtggaccgc       180
     ggctacttca aggaagcggg gctcgacgtg gagccgctca agttcgccgc cgcgcaacag       240
     atcatggaag gcatgctcgc gggccgttgc gacggcagcg ccaacggcac cggctcggcc       300
     aacctcgcga tcggcgagat cgcgcagccg ggcctcttca agatcttctg caccaacccg       360
     agcaacgcca agttcgtgct cgacgagttc atcgtcgcca aggacagccc cgtcaagacc       420
     gtggccgaac tggccggcaa gaaggtcgcc tcgggccccg gcatccagaa cgtcacgctg       480
     tgcaagacca tgctggagcg cgccggcgcc aagggcgcgg tggtgagcga gctgcccatc       540
     ggccagcacg tggcggcgct cgccgcaggc caggtcgatg cctgctacac gctggagccc       600
     accggcaccg tcggccgcat gaacggcacc acgcgggtga tcgaggcggg cgtcgtcgcc       660
     aggtacatcc tcggcgaccc gatggcgccg tggcatggcg gggcagcgag cctcacctcc       720
     gagttcatca agaagaaccc cgaggtcgcg aagaagtaca tcgcggcgta cgcccgcggc       780
     gtggaactgg tgcgcaccaa acccgacgac gcacgacagc acatgaaggg ctacaccgcc       840
     atcgaaggca agctcaccgc cgaagtgccg ctcgcctcgt acatgctcta caacgagttc       900
     aagccgagcg acgtcgcgta cttccagaag ttctacgacc tgttcaccga gaaaggcatc       960
     ttcgagaaga aggtgccggt ggacgcactt ctctacaagg cctga                      1005
//

If you have problems or comments...

PBIL Back to PBIL home page