(data stored in SCRATCH zone)

EMBL: CP002417.PE272

CP002417.PE272       Location/Qualifiers
FT   CDS_pept        289261..290088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0273"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: vap:Vapar_0267
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34495"
FT                   /db_xref="GOA:E6V1D1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1D1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU34495.1"
FT                   /translation="MADASTTTAAPWTPPASLNAAVPKPPLRDRLLPFIGPVALFIAWD
FT                   LVVRLGFIKPILLPSPADTIAALITGLAGGPLLTDFAMTVWRTLQAFVIAAVVGVPLGV
FT                   LLGSNEKAYRSVEFLIDFFRSTPSSALIPLFLLIFGVSDVNKIAIAAFGALLIVVFNSA
FT                   YGVINARKQRVMAAKVMGASRWQVFKDVLIWESLQPSFVGLRSAVSMALVIVIVAEMFI
FT                   GSDTGLGHRIIDAQQVLNVKSMYAAILAAGALGYALNILFLLAERRIVHWSGR"
     atggccgacg caagcacgac cacggccgcg ccgtggaccc cgccggccag cctcaacgcc        60
     gctgtgccca agccgcccct gcgcgaccgc ctgctgccct tcattggccc agtcgctctc       120
     ttcatcgcat gggacctggt ggtgcgcctg ggcttcatca agcccatcct gctgccctcg       180
     ccggccgaca ccatcgccgc gctcatcacg gggctcgcgg gcgggccgct gctcaccgac       240
     ttcgcgatga cggtgtggcg cacgctgcag gcctttgtca tcgctgcggt ggtcggcgtg       300
     ccgctgggcg tgctgctcgg cagcaacgag aaggcgtacc gcagcgtcga gttcctgatc       360
     gacttcttcc gctccacgcc atcgtccgcg ctcattccgc tgttcctcct gatcttcggc       420
     gtgagcgacg tcaacaagat cgccatcgcg gcgttcggcg cgctgctcat cgtggtgttc       480
     aacagcgcct acggcgtcat caatgcgcgc aagcaacgcg tcatggcggc caaggtcatg       540
     ggcgcctcgc gctggcaggt cttcaaggac gtgctgatct gggagagcct gcagcccagc       600
     ttcgtcggcc tgcgctcggc ggtgtcgatg gcgctggtga tcgtcatcgt ggccgagatg       660
     ttcatcggct ccgacaccgg cctcggccac cgcatcatcg atgcgcagca ggtgctcaac       720
     gtgaagagca tgtacgcggc gatcctggca gccggagcgc tcggctacgc gctcaacatt       780
     cttttcctcc tcgccgagcg ccgcatcgtg cactggagcg gacgatga                    828
//

If you have problems or comments...

PBIL Back to PBIL home page