(data stored in ACNUC1104 zone)

EMBL: CP002417.PE274

CP002417.PE274       Location/Qualifiers
FT   CDS_pept        290915..291295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0275"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0269 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34497"
FT                   /db_xref="InterPro:IPR024507"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1D3"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0269"
FT                   /protein_id="ADU34497.1"
FT                   /translation="MTLEINIPEVHAEVSAVFARYEEALVTNQRAVLDELFWNSPHTLR
FT                   YGFSENHYGHADISAFRASLPVQSPPRELLRTVITTYGHYFATANVEFRREGSREIGRQ
FT                   SQTWIRTADGWRVAAAHVSLPV"
     atgacattgg aaatcaatat ccccgaggtg cacgccgaag tcagcgccgt gttcgcgcgc        60
     tacgaagaag ccctcgtgac caaccagcgc gccgtgctcg acgagctgtt ctggaacagc       120
     ccgcacacgc tgcgctacgg cttctccgag aaccactacg gccacgccga catcagcgcc       180
     ttccgtgcat cgctgccggt gcagagcccg ccgcgcgagc tgctgcgcac cgtcatcacc       240
     acctacgggc actacttcgc gacggcgaac gtcgagttcc ggcgcgaagg cagccgcgag       300
     atcggccgcc agagccagac ctggatccgc accgccgacg gctggcgcgt ggccgccgcg       360
     cacgtgagcc tgcccgtctg a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page