(data stored in ACNUC1104 zone)

EMBL: CP002417.PE275

CP002417.PE275       Location/Qualifiers
FT   CDS_pept        291345..292463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0276"
FT                   /product="basic membrane lipoprotein"
FT                   /note="PFAM: basic membrane lipoprotein; Twin-arginine
FT                   translocation pathway, signal sequence, subgroup; KEGG:
FT                   vap:Vapar_0270 basic membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34498"
FT                   /db_xref="GOA:E6V1D4"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1D4"
FT                   /inference="protein motif:PFAM:PF02608"
FT                   /protein_id="ADU34498.1"
FT                   /translation="MTTPLNRRDSLKSLAALGAAGTLGGWSALASAQAKPLTVGVIYVG
FT                   ARDDYGYNQAHAMAAAEIKKLPGIKVVEEENVPETAAVQKTMAGMISQDGAKLLFPTSF
FT                   GYFDPHILAVAPKYPDVRFSHCGGLWTEGKHPKNAGSFFGYIDECQFLNGVIAAHMTKS
FT                   NKIAFVAAKPIPQVLRNINAFTLGARSVKPNITCSVIFTGDWSMAVKEAEATNSLADQG
FT                   CDVFTMHVDGPKVVVETAAKRGKMVCGYHASQAKLAPNAYLTGAEWNWLTAYKTAIEAA
FT                   QAGKPHPNFLRGGLKEGYVKMSAYGPMVPDAAKKQADDIKAKMIAGTFDIFKDGIKDNK
FT                   GAVVVPAGKVLKQTDLELEKMNYLVEGVIGQA"
     atgacaaccc cactcaatcg tcgcgattcc ctcaagtccc tggccgcgct cggcgccgcc        60
     ggcaccctcg gaggctggag cgccctcgcc agcgcacaag ccaagccgct taccgtcggc       120
     gtgatctacg tcggcgcgcg cgacgactac ggctacaacc aggcgcacgc catggccgcc       180
     gccgaaatca agaagctgcc cggcatcaag gtggtcgagg aagaaaacgt gcccgagacc       240
     gccgccgtgc agaagaccat ggccggcatg atttcgcagg acggcgccaa actcctgttc       300
     ccgacctcgt tcggctactt cgatccgcac atcctggccg tggcgcccaa gtaccccgac       360
     gtgcgcttct cgcactgcgg cggcctctgg accgaaggca agcacccgaa gaacgcgggc       420
     agcttcttcg gctacatcga cgagtgccag ttcctgaacg gcgtgatcgc cgcgcacatg       480
     accaagagca acaagatcgc cttcgttgcc gccaagccga ttccgcaggt gctgcgcaac       540
     atcaacgcct tcacgctcgg cgcgcgctcg gtcaagccga acatcacctg cagcgtgatc       600
     ttcaccggcg actggtctat ggccgtgaag gaggccgagg ccaccaacag cctggccgac       660
     cagggctgcg acgtgttcac catgcacgtc gacggcccca aggtggtggt cgagacagca       720
     gccaaacgcg gcaagatggt ctgcggctac cacgcgagcc aggccaagct cgcgcccaat       780
     gcgtacctca ccggcgccga gtggaactgg ctcaccgcct acaagaccgc catcgaggct       840
     gcgcaagccg gcaagccgca tcccaacttc ctgcggggcg gcctgaagga gggctacgtg       900
     aagatgtccg cctatggccc gatggtgccg gacgccgcga agaagcaggc cgacgacatc       960
     aaggccaaga tgattgcggg caccttcgac atcttcaagg acggcatcaa ggacaacaag      1020
     ggcgcggtcg tggtgccggc cggcaaggtg ctgaagcaga cggacctcga acttgaaaag      1080
     atgaactatc tcgtcgaagg cgtcatcggc caggcctga                             1119
//

If you have problems or comments...

PBIL Back to PBIL home page