(data stored in ACNUC1104 zone)

EMBL: CP002417.PE278

CP002417.PE278       Location/Qualifiers
FT   CDS_pept        294644..295636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0279"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: bra:BRADO7112 formamidase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34501"
FT                   /db_xref="GOA:E6V1D7"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR022843"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1D7"
FT                   /inference="protein motif:PFAM:PF00795"
FT                   /protein_id="ADU34501.1"
FT                   /translation="MSGLGGLNKSAHGVVVGLVQLQLPNVKTPADLAAQTQRICDMVGK
FT                   ARRNQSTMDLVVFPEYALHGLSMDTNPEIMCTLDGPEVAAFKRACIEHRIWGCFSIMEA
FT                   NPGGNPYNSGLVIDDQGEIKLYYRKLHPWVPVEPWEPGNLGIPVCDGPNGSKLALIICH
FT                   DGMFPEMAREAAYKGADIILRTAGYTAPIRHAWKITNQANAFCNLAYTASVCLCGSDGS
FT                   FDSMGEGMFCNFDGTVLVEGGGRVDEIITAELRPDLVREARTGWGVENNIYQLYHRGYV
FT                   AVKGGAQDCPYTYMHDMAAGTYRLPWSADVKVTDGTSCGFAPPERNYQG"
     atgagcggtc tgggtggcct caacaaatcg gcgcatggcg tcgtcgtcgg gctggtgcaa        60
     ctgcagttgc cgaacgtgaa gacgccggcc gaccttgccg cgcagacgca gcgcatctgc       120
     gacatggtgg gaaaggcgcg ccgcaaccag tcgacgatgg acctcgtggt gtttcccgag       180
     tacgcgctgc acggcctctc gatggacacc aaccccgaga tcatgtgcac gctcgacggc       240
     cccgaagtgg cggccttcaa gcgcgcgtgc atcgagcacc gcatctgggg ctgcttctcg       300
     atcatggagg ccaaccccgg cggcaacccc tacaacagcg ggctcgtcat cgacgaccag       360
     ggcgagatca agctctacta ccgcaagctg cacccgtggg tgccggtcga accgtgggag       420
     cccggcaacc tcggcattcc ggtgtgcgac ggacccaacg gcagcaagct cgcactgatc       480
     atctgccacg acggcatgtt ccccgagatg gcgcgcgagg ccgcatacaa gggcgccgac       540
     atcatcctgc gcacagcggg ctataccgcg ccgatccgcc atgcgtggaa gatcaccaac       600
     caggccaacg ccttctgcaa tctcgcctac acagcgagcg tgtgcctgtg cggcagcgac       660
     ggcagcttcg actcgatggg cgagggcatg ttctgcaact tcgacggcac ggtgctggtc       720
     gagggcggcg gccgggtcga cgagatcatc accgccgaac tgcggcccga cctcgtgcgc       780
     gaggcgcgca ccggctgggg cgtggaaaac aacatctacc agctctacca ccgcggctac       840
     gtcgcggtga agggcggcgc gcaggactgc ccctacacct acatgcacga catggctgcc       900
     ggcacctaca ggctgccgtg gagcgccgac gtgaaggtga ccgacggcac ctcctgcggc       960
     ttcgcgccgc cggaacgcaa ctaccaagga tga                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page