(data stored in ACNUC1104 zone)

EMBL: CP002417.PE279

CP002417.PE279       Location/Qualifiers
FT   CDS_pept        295645..296358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0280"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG:
FT                   vap:Vapar_0273 isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34502"
FT                   /db_xref="GOA:E6V1D8"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1D8"
FT                   /inference="protein motif:PFAM:PF00857"
FT                   /protein_id="ADU34502.1"
FT                   /translation="MTTAAATTAERHVAAEPYAWPYNGDLRPENTALIVIDMQTDFCGK
FT                   GGYVDVMGYDLSLVQAPIQPIARTLAALRPLGFHIIHTREGHRPDLADLPANKRWRSRQ
FT                   IGANGVGIGDDGPCGRILVRGEPGWELIPELAPLPGEVVIDKPGKGSFYATDLELILRT
FT                   RGIENLILAGITTDVCVHTTMRDANDRGFECLLLSDCTAATDHGNHLAALKMITMQGGV
FT                   FGAHTTSQQLLAALG"
     atgaccacag cagcagcaac caccgccgaa cgccatgtgg ccgccgagcc ctacgcctgg        60
     ccctacaacg gcgacctgcg acccgagaac accgcgctga tcgtcattga catgcagacc       120
     gacttctgcg gcaagggcgg ctacgtcgac gtgatgggct acgacctctc gctggtgcag       180
     gcgccgatcc agccgatagc gcgcacgctc gccgcgctgc ggccgctggg ctttcacatc       240
     atccacacgc gcgaaggcca ccggcccgac ctcgcggatc tgccggccaa caagcgctgg       300
     cgctcgcggc agatcggcgc caacggcgta ggcatcggcg acgacggccc gtgcggccgc       360
     atcctcgtgc gcggcgagcc gggctgggaa ctcattcccg aactcgcgcc gctgcccggc       420
     gaggtggtga tcgacaagcc cggcaagggc tcgttctatg ccaccgacct ggagctgatc       480
     ttgcggaccc gcggcatcga gaacctgatc ctcgcgggca tcacgaccga cgtgtgcgtg       540
     cacaccacga tgcgcgatgc gaacgaccgc ggcttcgaat gtttgctgct gtcggactgc       600
     acggccgcca ccgaccacgg caatcacctc gcggcgctga agatgatcac gatgcagggc       660
     ggcgtgttcg gcgcgcacac gacctcgcag cagctgctgg ccgcgctggg ctga             714
//

If you have problems or comments...

PBIL Back to PBIL home page