(data stored in ACNUC1104 zone)

EMBL: CP002417.PE28

CP002417.PE28        Location/Qualifiers
FT   CDS_pept        complement(31088..32527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0028"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: vap:Vapar_0026 sensory histidine kinase CreC;
FT                   PFAM: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34251"
FT                   /db_xref="GOA:E6UXQ7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXQ7"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADU34251.1"
FT                   /translation="MTRRTRIFIGILLIYTAGIAFLLYRVVSDIDPRYRESAEESLVET
FT                   SQLMASLVEQDVIAGAINTGRLEPLFRTVYAREFSAQIYNLHKSQVELRVYVTDRSGRV
FT                   MFDSLGRHLGADYSQWSDVSRTLAGLYGARTSRDVDGDPRTSVMYVGAPIRWNNEIVGM
FT                   VSVGKPVQSFGQFVEDARARTLWVGVGSGLALLLLAVIVSVWLVRPFGLISDYWTWVRA
FT                   QRTLSFSRMARRAVDAVRTGFSEMRDALTGRNYVADYVQTFTHEVKSPLSAIRGAAELL
FT                   QEPSMPHAERERFLKNIERETQRIQEIVDRMMELTALETRRALERTEPVPLASLIDDIA
FT                   ISAQPAAAKRNIRLLVNIRTEASTEGDPFLLRRAISNLLDNAIDFSPPDSEVLLTLETT
FT                   SKLARVTVRDHGPGIPDYAQEKVFQKFYSLARPHSQKKSTGLGLAFVKEIASLHRGRIE
FT                   LGNATRGGAVATLTLPLLSHH"
     gtgacaagac gcacgcggat cttcatcggc atcctgctga tctacacggc gggcatcgcc        60
     tttctgctct accgcgtggt gtcggacatc gatccgcgct accgcgaatc agccgaagag       120
     tcgctggtcg agacctcgca gctcatggcc agcctggtcg agcaggacgt gatcgcgggc       180
     gccatcaaca ccgggcgact ggagcccctg ttccgcaccg tctacgcgcg cgagttctcc       240
     gcgcagatct acaacctgca caagagccag gtggaactgc gcgtgtacgt caccgaccgc       300
     agcggccgcg tgatgttcga ttcgctcggc aggcacctgg gcgccgacta ctcgcaatgg       360
     agcgacgtga gccgcacgct cgccggcctt tatggcgcgc gcacctcgcg cgatgtcgac       420
     ggcgatccgc gcacttcggt gatgtacgtg ggcgcgccca ttcgctggaa caacgagatc       480
     gtcggcatgg tcagcgtcgg caagccggtg cagagcttcg gccagttcgt ggaagacgcg       540
     cgcgcccgca cgctgtgggt gggcgtgggt tcgggcctcg cgctgttgct gctggcggtg       600
     atcgtctcgg tctggctggt gcggcccttc gggctgatct cggactactg gacctgggtg       660
     cgcgcgcagc gcaccctgag cttttcgcgc atggcgcggc gcgcggtcga tgcggtgcgc       720
     accggcttca gcgaaatgcg cgatgcactg acgggccgca actacgtcgc cgactacgtg       780
     cagaccttca cgcacgaagt gaaaagtcca ctttcggcga tccgcggcgc agccgagctg       840
     ctgcaggagc cgtcgatgcc gcatgcggag cgcgagcggt tcctgaagaa catcgagcgc       900
     gagacgcagc gcatccagga aatcgtcgat cgcatgatgg agctcaccgc gctcgaaacg       960
     cggcgcgcgc tggagcgcac cgagccggtg ccgctggctt cgctgatcga cgacatcgcc      1020
     atcagcgcgc agcccgcggc ggccaagcgg aacattcgcc tgctggtgaa catccgcacc      1080
     gaagccagca ccgagggcga cccgttcttg ttgcgccgcg cgatcagcaa tctgttggac      1140
     aacgcgatcg atttttcacc gcccgacagc gaggtgctgc tgacgctgga gaccacgtcg      1200
     aagctcgcac gcgtgaccgt gcgcgaccat ggcccgggca ttccggacta cgcgcaggaa      1260
     aaagtcttcc agaagttcta ttcgctcgcg cggccgcaca gccagaagaa aagcacgggg      1320
     ctggggctcg cgttcgtgaa ggaaatcgcc tcgctgcacc gagggcgcat cgagctcggc      1380
     aatgcgacgc gcggcggcgc ggtggccacg ctcacgctgc cgctgttgtc acatcactga      1440
//

If you have problems or comments...

PBIL Back to PBIL home page