(data stored in ACNUC1104 zone)

EMBL: CP002417.PE280

CP002417.PE280       Location/Qualifiers
FT   CDS_pept        296366..297940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0281"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: vap:Vapar_0274 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34503"
FT                   /db_xref="GOA:E6V1D9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1D9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU34503.1"
FT                   /translation="MSAVPHAIGALPAGSGALALDTYELTKRFGAFTAMDRVTMRVEPG
FT                   TVHALLGENGAGKSTLVKCVAGFQRAEEGSILIDGREQDIANPIVARALGIGMVYQHFT
FT                   LAPGMTVAENLLLAGGKTPALIDWKTKRAELKAFLATTPFSLDLDVRPSELAAGEKQKL
FT                   ELLKQLYLKPRLLILDEPTSVLTPQEADEVLGHVREFARSGLCTVLIITHKFREVMAYA
FT                   DSVTVLRRGKAVHHCRVADTSPAQLAQAMMGGEDAAVATPASSPAIRKPVADAAPIALK
FT                   VEGLKAQGDRGTLALHDLSLAVRAGEILGVAGVSGNGQRELVEALVGQRPRLAGRVSVM
FT                   GQPYNARRAENRSLKVRSLPEEPLRNACVGDLSVAENMALRDFDRPPLSRGGVLNFPYW
FT                   RSRAREWIAEYGVKTQGEGAPIRSLSGGNVQRAVLARELAGDINVLIAANPVFGLDFAA
FT                   VAEIHERIVQVREKGGAVLLISEDLDELLELADRIVVMSEGQIVFETSAAGAERHVIGA
FT                   HMGGGHH"
     atgagcgccg ttcctcacgc catcggcgca ctgcccgcgg gcagcggcgc actcgcgctc        60
     gacacctacg agttgaccaa gcgcttcggc gccttcaccg cgatggaccg cgtgacgatg       120
     cgcgtcgaac ccggcacggt gcatgcgctg cttggcgaga acggcgcggg caagagcacg       180
     ctggtgaaat gcgtggccgg tttccagcgc gcggaggagg gcagcatcct gatcgacggg       240
     cgcgagcagg acatcgccaa ccccatcgtc gcgcgcgcgc tgggcatcgg catggtctac       300
     caacacttca cgctggcgcc gggcatgact gtcgccgaga acctgctgct ggccggcggc       360
     aagacgcccg cgctgatcga ctggaagacc aagcgcgcgg agctgaaggc gtttctcgca       420
     accacgccct tcagcctcga cctcgatgtg cggccttcgg agcttgcagc gggcgagaag       480
     cagaagctcg aactgttgaa gcagctgtac ctgaagccgc gcctcctgat cctcgacgag       540
     cccacctcgg tgctcacgcc gcaggaggcc gacgaggtgc tgggccatgt gcgcgagttc       600
     gcgcgcagcg ggctgtgcac cgtgctcatc atcacgcaca agtttcgcga agtgatggcg       660
     tatgcggaca gcgtgacggt gctgcgcagg ggcaaagccg tgcatcactg ccgcgtggcc       720
     gacacgagcc cggcgcaatt ggcgcaggcc atgatgggtg gcgaagatgc ggcggttgcc       780
     acgccggctt catcgcctgc catcaggaag cccgtggccg atgcggcgcc catcgcgttg       840
     aaggtcgaag gcctaaaggc gcaaggcgac cgcggcacgc tcgcgctgca tgacctgagc       900
     ctggccgtgc gcgcgggaga aatactcggc gtggcgggcg tctccggcaa cggacaacgc       960
     gaactggtcg aggccctggt cgggcagcgc ccgcggctgg ccggccgcgt gagcgtgatg      1020
     ggccagccgt acaacgcgcg ccgcgccgag aaccgcagcc tcaaggttcg cagccttccc      1080
     gaggagccgc tgcgcaacgc ctgcgtgggc gacctcagcg tggcggagaa catggcgctg      1140
     cgcgatttcg acaggccgcc cttgtcgcgc ggcggcgtgc tgaactttcc gtactggcgc      1200
     agccgcgcac gcgaatggat cgccgagtac ggcgtcaaga cgcagggcga gggcgcgccg      1260
     atccgcagtc tttcgggcgg caacgtgcag cgcgcggtgc tcgcgcgcga gctggccggc      1320
     gacatcaacg tgctgatcgc ggcgaacccg gtgttcggcc tcgacttcgc cgccgtcgcg      1380
     gagattcacg aacgcatcgt gcaggtgcgc gagaagggcg gggcggtttt gttgatcagc      1440
     gaagacctcg acgagctgct cgagctggcc gaccgcatcg tggtgatgag cgaagggcag      1500
     atcgtgttcg agacttctgc cgcgggtgcg gagcgccacg tcatcggcgc gcacatgggc      1560
     ggcggacacc actga                                                       1575
//

If you have problems or comments...

PBIL Back to PBIL home page