(data stored in SCRATCH zone)

EMBL: CP002417.PE283

CP002417.PE283       Location/Qualifiers
FT   CDS_pept        complement(299443..300405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0284"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_5386 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34506"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1E2"
FT                   /inference="similar to AA sequence:KEGG:Vapar_5386"
FT                   /protein_id="ADU34506.1"
FT                   /translation="MRFIAKTLTTLLVAASAAAAHAWPDQPITLVVPYTPGTGIDLVAR
FT                   QLSARLPALLGQPVIVENLAGASGNIGSEKVARAKPDGYTLLVQVNTLVMNRSLYKSLS
FT                   YDPVADFAPASLTSWGTLLLVTNPNVQKATSVAQMVSAAKAEPAKLTYATPGVGTPHHL
FT                   SMALLMQGTGTDLLHVPYKGTAGAVTDLLGGRIDYMFLPVHVALQHIQAGKLKAIATGS
FT                   SKRLPQLPDVPTLAEAGVTADNVDMWYGVLAPKGTPPDVVARLNKEIAAVLKQPDVAKS
FT                   FESQGMVPASSTPGEFGALVKKDAERWAGVVKRGNITAD"
     atgcgattca ttgccaagac cctgaccacc ctgctcgttg cggcaagcgc cgccgcggcc        60
     cacgcctggc ccgaccagcc gatcacactc gtcgtgccct acacgccggg caccggcatc       120
     gacctcgtcg cgcgccaact ctccgcgcgc ctgcccgcgc tgctgggcca gccggtgatc       180
     gtggagaacc tcgccggcgc gagcggcaac atcggcagcg agaaagtcgc gcgcgccaag       240
     cccgacggct acacgctcct ggtgcaggtc aacacgctgg tgatgaaccg cagcctttac       300
     aagtcattga gctacgaccc cgtggccgac ttcgcgccgg cgtcgctcac ctcgtggggc       360
     acgctgctgc tggtgaccaa cccgaacgtg cagaaggcga cgtcggtcgc gcagatggtg       420
     agcgcggcca aggcggagcc ggccaagctg acgtacgcca cgccaggcgt gggcacgccg       480
     catcaccttt cgatggcgct cctgatgcag ggcaccggca ccgacctgct gcacgtgccg       540
     tacaagggta cggccggcgc ggtgacagac ttgctcggcg ggcgcatcga ctacatgttc       600
     ctgccggtgc acgtggcgct gcagcacatc caggccggca agctcaaggc cattgccacc       660
     ggcagcagca agcggctgcc gcaattgccc gatgtgccca cgctcgccga ggctggcgtg       720
     actgccgaca acgtggacat gtggtacggc gtgctcgcgc ccaagggcac gccgcctgat       780
     gtggttgcgc ggctcaacaa ggagatcgct gcggtgttga agcaacccga cgtggcgaag       840
     tccttcgagt ctcaggggat ggtgccggcg agctcgacgc cgggggagtt cggggcgctg       900
     gtgaagaagg atgcggagcg gtgggcgggg gtggtgaagc gggggaacat caccgcggac       960
     tga                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page