(data stored in ACNUC1104 zone)

EMBL: CP002417.PE284

CP002417.PE284       Location/Qualifiers
FT   CDS_pept        complement(300449..301690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0285"
FT                   /product="monooxygenase FAD-binding protein"
FT                   /note="PFAM: monooxygenase FAD-binding; KEGG:
FT                   vap:Vapar_5387 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34507"
FT                   /db_xref="GOA:E6V1E3"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1E3"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /protein_id="ADU34507.1"
FT                   /translation="MNDKQVIILGAGIGGLTLALSLHQAGIACRVYEAVPELEPLGVGV
FT                   NLLPHAVRELTELGLLPQLDKVGVRTKESIFFTEHGQLIFQEAAGEHAGYDWPQFSIHR
FT                   GDLQTVLLEETLKRLGPDSVVCNHRCTGVTQDAGGVTVHFADAPAVRGAVAIGCDGIHS
FT                   ALRKQLYPNEGAPRYSGVNMWRGTARWKPFLSGASMVRAGWLAVGKMVIYPIRNDIDAE
FT                   GHQLVNWVAEIHAPQPAMRDWSRAGRLEDFLPAFADWHFYWLDVPALIRASDTILEYPM
FT                   VDQDPLPRWTHGRLTLLGDAAHPMVPRGSNGAGQAIIDARFLAGALKDLGVGTAALEDY
FT                   DRARVKATTNVVLTNRSNPPDAILREVFERSGGKRFGQIEDVVSHAELQAISDNYKRVA
FT                   GYDPVALKARASYL"
     atgaacgaca agcaagtgat catcctgggc gccggcatcg gcggcctgac cctcgcgctg        60
     agcctgcatc aggccggcat cgcatgccgc gtttacgagg ccgtgcccga actcgagccg       120
     ctgggcgtgg gcgtgaacct gctgccgcat gcggtgcgcg agctgaccga gctcggcctg       180
     ctgccacaac tggacaaggt gggcgtgcgc acgaaggagt cgatcttctt caccgagcac       240
     gggcagttga tctttcagga ggccgcgggc gaacatgcgg gctacgactg gccgcagttc       300
     tcgatccatc gcggtgatct gcagacggtg ctgctcgaag aaacgctcaa gcgcctcggc       360
     cccgacagcg tggtctgcaa ccaccgctgc accggcgtga cgcaggacgc gggcggcgtc       420
     accgtgcatt tcgctgacgc acctgctgta cgcggtgccg tagccatcgg ttgcgacggc       480
     attcactcgg ccttgcgcaa gcagctctat cccaacgaag gcgcgccgcg ctattcgggc       540
     gtgaacatgt ggcgcggcac cgcgcgatgg aagccttttc tctcgggcgc gagcatggtg       600
     cgcgcggggt ggctcgcggt cggcaagatg gtgatctacc cgatccgcaa cgacatcgac       660
     gccgaaggcc accagctcgt gaactgggtc gccgagatcc acgcgccgca gcccgcgatg       720
     cgcgactgga gccgcgccgg ccggctcgag gactttctcc cggcgttcgc cgactggcac       780
     ttctactggc tcgacgtgcc cgcgctgatc cgcgcatcgg acaccatcct ggagtacccg       840
     atggttgacc aggacccgct gccgcgctgg acgcacggcc gcctcacgct cctgggcgac       900
     gccgcacacc cgatggtgcc gcgcggctcc aacggcgcgg gacaggcgat catcgatgcg       960
     cgttttcttg cgggcgcgct caaggacctg ggcgtcggca ccgcggcgct ggaggactac      1020
     gaccgcgcgc gcgtgaaggc caccaccaac gtggtgttga ccaaccgcag caacccgccc      1080
     gacgcgatcc tgcgcgaagt gttcgagcgc tcgggcggca agcgcttcgg gcagatcgag      1140
     gacgtggtga gccacgccga gctgcaggcc atttcggaca actacaagcg cgtggcgggc      1200
     tacgacccgg tcgcgctgaa ggcgcgcgcc tcctacctct ga                         1242
//

If you have problems or comments...

PBIL Back to PBIL home page