(data stored in ACNUC1104 zone)

EMBL: CP002417.PE285

CP002417.PE285       Location/Qualifiers
FT   CDS_pept        301790..302704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0286"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: vap:Vapar_5388 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34508"
FT                   /db_xref="GOA:E6V1E4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1E4"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADU34508.1"
FT                   /translation="MNLSTRQMRAFLQVARLGNFTRAAEQAHITQAGLSILIREMEKQL
FT                   GCRLFDRTTRVVTLTPAGRRLLPVVERLVTDLDDVAAQLGAEGDEARQTLRIAATPLVS
FT                   SHLLPQVFNTFRQAHPQVSLRLFDADLRDVEAMVTAGDADMGLGFFFKAAAGLERTPVG
FT                   RFHLMRVASSSADEVDEAPAIGTAPWSALRSAELIGLPPGNPIQKVIDQHLVATIGRAD
FT                   AQRPTFNFFGTLISMVEAGFGTAVMPTFALAACRRHRVRTDVLVKPKVGLDFYRIAKRG
FT                   THETEAMQAFVATLEKALPALSR"
     atgaacctct cgacccgcca gatgcgcgcc ttcctgcagg tggcgcgcct gggcaacttc        60
     acacgcgcgg cggagcaggc ccacatcacg caggcggggc tcagcatcct gatccgtgag       120
     atggaaaagc agttgggctg ccggctcttc gaccgcacca cgcgcgtggt gacgctcacg       180
     ccggcgggcc ggcggctgct gccggtggtg gagcgcctcg tcaccgacct ggacgacgtg       240
     gccgcgcagc tcggcgccga gggcgatgag gcgcggcaga ccctgcgcat cgcggcgacg       300
     ccgctggtgt cctcgcacct gctgccgcaa gtcttcaaca ccttccgcca ggcgcatccg       360
     caagtgagcc tgcgtctctt cgatgccgac ctgcgcgatg tggaagcgat ggtcacggcc       420
     ggcgatgcgg acatgggcct cggcttcttc ttcaaggcgg cagcgggcct ggagcgcacg       480
     ccggtcgggc gctttcacct gatgcgcgtg gcgtcgtctt cagcggatga agttgatgaa       540
     gcgccggcca tcggcaccgc gccgtggtcc gcgctgcgca gcgccgaact catcggcctg       600
     ccgccgggca acccgatcca gaaggtgatc gaccagcacc tggtggccac catcggccgc       660
     gccgatgcgc agcggcccac cttcaatttc ttcggcacgc tgatctcaat ggtcgaggcc       720
     ggcttcggca ccgcggtgat gccgaccttc gcgctcgcgg cctgccgccg ccaccgggtg       780
     cgcaccgacg tgctggtcaa gccgaaggtg gggctggact tctatcgcat cgccaagcgc       840
     ggcacgcacg agaccgaggc gatgcaggcc ttcgtcgcga cgctggagaa ggcgctgccc       900
     gcgctctcgc gctga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page