(data stored in ACNUC1104 zone)

EMBL: CP002417.PE287

CP002417.PE287       Location/Qualifiers
FT   CDS_pept        303531..304214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0288"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="TIGRFAM: orotate phosphoribosyltransferase; KEGG:
FT                   vap:Vapar_0278 orotate phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34510"
FT                   /db_xref="GOA:E6V1E6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1E6"
FT                   /inference="protein motif:TFAM:TIGR00336"
FT                   /protein_id="ADU34510.1"
FT                   /translation="MAVDGEKSSAVAQDFVQFARDAGVLRFGEFKTKAGRMSPYFFNSG
FT                   LFDDGAKIARLAGFYADRLIESGLEFDMIFGPAYKGIPLGATVAAELARRGRNYPFAYN
FT                   RKEAKAHGEGGNLVGAPLQGRVLIVDDVMSAGTAVRESIAAIQAAGATPHAVAIALDRQ
FT                   EKATENGVDVDHSAVQYVRNQLGLSVIAIATLDDLLSYLSGDAAADLGAHRERVLAYRT
FT                   RYGAH"
     atggctgtag atggtgagaa aagcagcgcg gtggcgcagg acttcgtcca gttcgcgcgc        60
     gatgccggcg tgcttcgctt cggcgagttc aagaccaagg ccggccggat gagcccctac       120
     ttcttcaatt cggggctctt cgacgacggc gccaagatcg cacggctcgc gggattctat       180
     gcagaccggc tgatcgagag cggcctcgaa ttcgacatga tcttcggccc cgcctacaag       240
     ggcattccgc tgggcgccac agtggccgcc gagctggcgc ggcgcggccg caactacccc       300
     tttgcctaca accgcaagga agccaaggcg cacggcgagg gcggcaacct ggtgggcgcg       360
     ccgctccagg gccgcgtgct gatcgtcgac gacgtgatgt ccgccggcac cgcggtgcgc       420
     gaatcgatcg ccgcgatcca ggccgccggc gccacgccgc atgccgtggc catcgcgctc       480
     gaccgccagg aaaaagccac cgagaacggc gtcgacgtgg accacagcgc cgtgcagtac       540
     gtgcgcaacc agctcggcct ttcggtgatc gccattgcca cgctggacga cctgctgagc       600
     tacctctcgg gcgatgccgc cgccgacctg ggcgcgcacc gcgagcgcgt gctggcctac       660
     cgcacgcgct acggcgccca ctga                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page