(data stored in SCRATCH zone)

EMBL: CP002417.PE29

CP002417.PE29        Location/Qualifiers
FT   CDS_pept        complement(32524..33318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0029"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: vap:Vapar_0027 two component transcriptional
FT                   regulator, winged helix family; PFAM: response regulator
FT                   receiver; transcriptional regulator domain-containing
FT                   protein; SMART: response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34252"
FT                   /db_xref="GOA:E6UXQ8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXQ8"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADU34252.1"
FT                   /translation="MSFKPRILIAEDESGIADTLQYVLKSDGFTPVWCATAEEAIAQFA
FT                   EEPPALAILDIGLPDLNGFELFKRLRALNQSQGGPEVPMLFLTARSDEIDRVVGLELGA
FT                   DDYIAKPFSPRELVARVRTILRRSTRNSPGGPGTAAGPGNGVPPQISPPAPPTAPQTPP
FT                   MPFALDNERMQIRYYGRLLELSRYEYGLLRLLVQRPGRVFTRDELLEHVWDDASDSFDR
FT                   TVDAHIKTLRAKLKAVAPDVEPIRTLRGTGYALNEELPAKAS"
     atgagcttca aaccccggat cctgatcgcc gaagacgaat cgggcatcgc cgacacgctg        60
     caatacgtcc tgaagagcga tggcttcacg ccggtctggt gcgccaccgc cgaagaggcc       120
     atcgcgcagt tcgcagagga gccgcccgcg ctggccatcc tggacatcgg gctgcccgat       180
     ctcaacggtt tcgagctctt caagcgcctg agagcgctga accagtcgca gggcgggccg       240
     gaggtcccga tgctgtttct cacggcgcgc agcgacgaaa tcgaccgcgt ggtgggcctg       300
     gaactgggcg ccgacgacta catcgccaag ccgttttcgc cgcgcgaact ggtcgcgcgg       360
     gtccgaacga tcctgcggcg cagcacgcgc aacagccctg gaggccccgg aacggccgca       420
     gggcccggaa acggggtacc ccctcaaatt tcgccgccgg cgccgccaac ggccccacag       480
     accccgccaa tgcccttcgc gctcgacaac gagcgcatgc agatccgcta ttacggccgg       540
     cttctggagc tctcgcgcta cgaatacggc ttgctgcggc tgctggtgca gcggccgggc       600
     cgcgtcttca cccgcgacga attgctggaa cacgtttggg acgacgcgag cgacagcttc       660
     gaccgcacgg tcgatgcgca catcaagacc ctgcgcgcca agctcaaggc ggtggcgccc       720
     gatgtggagc cgatccgcac gctgcgcggc accggctatg ccctgaacga agaattgcca       780
     gccaaggctt cgtga                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page