(data stored in ACNUC1104 zone)

EMBL: CP002417.PE292

CP002417.PE292       Location/Qualifiers
FT   CDS_pept        308464..309507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0293"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="KEGG: vap:Vapar_0283 rod shape-determining protein
FT                   MreB; TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell shape determining protein MreB/Mrl"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34515"
FT                   /db_xref="GOA:E6V284"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:E6V284"
FT                   /inference="protein motif:TFAM:TIGR00904"
FT                   /protein_id="ADU34515.1"
FT                   /translation="MFGAFRRYFSTDLAIDLGTANTLIFARNKGIVLDEPSVVAIRHEG
FT                   GPHGKKVIQAVGREAKAMLGKVPGNIEAIRPMKDGVIADFVITEQMIKQFIKMVHPRTL
FT                   LTPSPRIIICVPCGSTQVERRAIKDAAEAAGATSVYLIEEPMAAAIGAGLPVSEASGSM
FT                   VVDIGGGTTEVGVISLGGMVYKGSVRVGGDRFDEAIINYIRRNYGMLIGEPTAEVIKKT
FT                   IGSAFPGSEVKEMEVKGRNLSEGVPRSFTISSNEVLEALTDPLNNIVSAVKNALEQTPP
FT                   ELGADIADRGMMLTGGGALLRDLDRLLAEETGLPVLVAEDPLTCVVRGCGIALERMDRL
FT                   GSIFTSE"
     atgtttggag ctttccgtcg gtacttttcc accgaccttg cgatcgacct cggcaccgcc        60
     aacaccctga tattcgcccg caacaagggc atcgtgctgg acgagccctc ggtcgtcgcg       120
     atccgccacg aaggcggccc ccacggcaag aaggtgatcc aggccgtcgg ccgcgaagcc       180
     aaggccatgc tgggcaaggt gcccggcaac atcgaggcga tccgcccgat gaaagacggc       240
     gtgatcgccg acttcgtgat cacggagcag atgatcaagc agttcatcaa gatggtgcac       300
     ccgcgcacgc tgctcacgcc gagcccgcgc atcatcatct gcgtgccttg cggctcgacc       360
     caggtcgagc gccgcgccat caaggacgcg gccgaagctg ccggcgccac gtcggtctat       420
     ctcatcgaag aacccatggc cgcggccatc ggcgccggcc tccccgtcag cgaggcctcg       480
     ggctcgatgg tggtggacat cggcggcggc accaccgaag tgggcgtcat ctcgctgggc       540
     ggcatggtct acaaggggtc ggtgcgcgtg ggcggcgacc gcttcgacga agccatcatc       600
     aactacatcc gccgcaacta cggcatgctg atcggcgagc cgacggccga agtcatcaag       660
     aagaccatcg gctcggcctt cccgggctcc gaagtcaagg aaatggaagt caagggccgc       720
     aacctttccg aaggcgtccc gcgcagcttc accatcagca gcaacgaagt gctggaagcc       780
     ctgaccgatc cgctcaacaa catcgtctcg gccgtgaaga acgcgctgga gcagacgccg       840
     cccgaactgg gcgccgacat cgccgaccgc ggcatgatgc tcaccggcgg cggcgccctg       900
     ctgcgcgacc tcgaccgcct gctggccgag gaaacgggcc tcccggtgct cgtggccgaa       960
     gacccgctga cttgcgtggt gcgcggctgc ggcatcgccc tggagcgcat ggaccgtctg      1020
     ggcagcatct tcactagcga gtaa                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page