(data stored in ACNUC1104 zone)

EMBL: CP002417.PE296

CP002417.PE296       Location/Qualifiers
FT   CDS_pept        complement(313252..314520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0297"
FT                   /product="fumarylacetoacetase"
FT                   /EC_number="3.7.1.2"
FT                   /note="TIGRFAM: fumarylacetoacetase; KEGG: vap:Vapar_0287
FT                   fumarylacetoacetase; PFAM: Domain of unknown function
FT                   DUF1969; fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34519"
FT                   /db_xref="GOA:E6V288"
FT                   /db_xref="InterPro:IPR005959"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR015377"
FT                   /db_xref="InterPro:IPR036462"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:E6V288"
FT                   /inference="protein motif:TFAM:TIGR01266"
FT                   /protein_id="ADU34519.1"
FT                   /translation="MTALNATHDPKLRSWVASANEAGTDFPIQNLPFGRFRTAGSSEAF
FT                   RIGVAIGDQVLDLKAAGLVDTDDMNALMGASVKDRQALRAAISAGLAEGSDKQAAWSKA
FT                   LLAQAKAEMTVPCRIGDYTDFYTGIHHATTIGKLFRPDQPLMPNYKWVPIGYHGRASSI
FT                   GVSGQVFKRPQGQTKAPDAAEPSFGPSKRLDYELELGFLVGQGNALGEPIAIGEAEEHL
FT                   FGVTLLNDWSARDLQAWEYQPLGPFLAKNFASTLSPWIVTMEALAPFRARFERPAGDPQ
FT                   PLPYLDAPSNREAGALDITLEVLLQTAKMRAEGIAPARLTRGNTTEAAYWTAAQLITHH
FT                   TVNGCNLQPGDLLGSGTLSGPKPDEAGSLMELTLGGKQPITLPNGEKRTFLEDGDTLVM
FT                   RGYCERAGAVRIGLGEVSGTVAG"
     atgaccgcac tgaacgccac ccacgacccc aagctgcgca gctgggtcgc ctcggccaac        60
     gaagccggca ccgacttccc gatccagaac ctgcccttcg gccgcttccg caccgcgggc       120
     agcagcgagg ccttccgcat cggcgtcgcg atcggcgacc aggtgctcga cctgaaggcc       180
     gcgggcctcg tggacaccga cgacatgaac gcgctgatgg gcgcgagcgt gaaggaccgc       240
     caggccctgc gcgccgcgat ctccgcgggc ctcgccgaag gcagcgacaa gcaggccgca       300
     tggtcgaagg cgctgctcgc gcaagccaag gccgagatga cggtgccctg ccgcatcggc       360
     gactacaccg acttctacac gggtatccac cacgcgacca ccatcggcaa gctcttccgc       420
     cccgaccagc cgctgatgcc caactacaag tgggtgccca tcggttatca cggccgcgcc       480
     tcgtccatcg gcgtgagcgg ccaggtcttc aagcgcccgc agggccagac caaggcgccc       540
     gatgcggccg agccgagctt cggcccgtcc aagcgcctcg actacgaact ggagctgggc       600
     tttctggtcg gccagggcaa cgcgctgggc gagccgatcg ccatcggcga ggccgaagag       660
     cacctgttcg gtgtgacgct gctcaacgac tggtcggcac gcgacctgca ggcctgggaa       720
     taccagccgc tcggcccgtt cctcgcgaag aacttcgcga gcacgctgtc gccgtggatc       780
     gtgaccatgg aggcgctcgc gccgttccgc gcgaggttcg agcggcccgc gggcgatccg       840
     caaccgctgc cgtatctcga tgcgccgtcg aaccgcgagg ccggcgcgct cgacatcacg       900
     ctcgaagtgc tgctgcagac cgcgaagatg cgcgccgaag gcatcgcgcc cgcgcgcctc       960
     acgcgcggca acaccaccga ggccgcctac tggaccgccg cgcagctcat cacgcaccac      1020
     acggtgaacg gctgcaacct gcagccgggc gacctgctgg gctcgggcac gctctcgggg      1080
     ccgaagcccg acgaggccgg ttcgctgatg gaactcacgc tgggcggcaa gcagccgatc      1140
     acgctgccga acggcgagaa gcgcacgttc ctggaagacg gcgacacgct ggtcatgcgc      1200
     ggctactgcg agcgcgcggg ggctgtgcgt atcgggctgg gtgaagtcag cggcacggtg      1260
     gctggctga                                                              1269
//

If you have problems or comments...

PBIL Back to PBIL home page