(data stored in ACNUC1104 zone)

EMBL: CP002417.PE297

CP002417.PE297       Location/Qualifiers
FT   CDS_pept        complement(314678..315655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0298"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0288 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34520"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:E6V289"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0288"
FT                   /protein_id="ADU34520.1"
FT                   /translation="MMKNAFALTRRAAALALLAAPLLTHAADFPSKPIRFIVPYTPGGT
FT                   TDLVARTVGQKVSEKLGQPVLIDNRGGAGGNIGMDAVAKAAPDGYTIGFGAISTNALNP
FT                   HIYKSMAFDPRKDFTAISLLGTSTIVLEVPAASPIKSVPDLIAAAKKNPGLPYATAGAG
FT                   TSMNLAGVMFAQMTGTELVHVAYKGSGPAITDMLGNNIGLMFDNLPASLPHIQAGKLRA
FT                   LAVAGPARSPSLPDVPTMAEAGLKGYALDPWFGVYGPANLPAPVVKALNEAFVEALAMP
FT                   DVKAKLQQAGFSPRGSTAQELATLTQTEYQRLGDVARKAGMTAD"
     atgatgaaga acgccttcgc tctcacgcgc cgcgcggcgg ctctcgccct gctcgctgcg        60
     cccttgctca cgcacgcggc ggactttccg tcgaagccga ttcgcttcat cgtgccctac       120
     acgcccggcg gcaccaccga cctcgtggcg cgcaccgtgg gccagaaggt gtcggaaaag       180
     ctcggccagc cggtgctcat cgacaaccgc ggcggcgcgg gcggcaacat cggcatggac       240
     gccgtggcca aggccgcccc cgacggctac accatcggct tcggcgcgat ctcgaccaat       300
     gcgctgaacc cgcacatcta caagtcgatg gccttcgatc cgcgcaagga cttcacagcg       360
     atcagcctgc tgggcacctc gaccatcgtg ctcgaagtgc cggccgcctc gccgatcaag       420
     tcggtgcccg acctgatcgc cgccgcgaag aagaacccgg gcctgcccta cgccaccgcg       480
     ggcgccggca cctcgatgaa cctggcgggc gtgatgttcg cgcagatgac cggcaccgag       540
     ctcgtgcacg tggcctacaa gggcagcggc ccggccatca ccgacatgct gggcaacaac       600
     atcggcttga tgttcgacaa cctgccggcg tcgctgccgc acatccaggc cggcaagctg       660
     cgcgcgctgg ctgtcgccgg gccggcgcgg tcgccttcgc tgcccgacgt gccgacgatg       720
     gctgaggcgg gcctcaaggg ctacgcgctc gatccgtggt tcggtgtgta cggaccggcg       780
     aacctgccgg cacccgtggt caaagcgctg aacgaagcct tcgtcgaagc gctcgcgatg       840
     ccggacgtga aggccaagct gcagcaggcc ggcttctcgc cgcgcggctc gaccgcgcag       900
     gagctggcga cgctcacgca gaccgaatac cagcgcctcg gtgatgtggc caggaaagcc       960
     ggcatgaccg cggactga                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page