(data stored in ACNUC1104 zone)

EMBL: CP002417.PE298

CP002417.PE298       Location/Qualifiers
FT   CDS_pept        complement(315652..316959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0299"
FT                   /product="homogentisate 1,2-dioxygenase"
FT                   /EC_number="1.13.11.5"
FT                   /note="TIGRFAM: homogentisate 1,2-dioxygenase; KEGG:
FT                   vap:Vapar_0289 homogentisate 1,2-dioxygenase; PFAM:
FT                   homogentisate 12-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34521"
FT                   /db_xref="GOA:E6V290"
FT                   /db_xref="InterPro:IPR005708"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E6V290"
FT                   /inference="protein motif:TFAM:TIGR01015"
FT                   /protein_id="ADU34521.1"
FT                   /translation="MTDIPATERRYLGGFGNEYASEAVPGALPQGRNNPQRGPFDLYTE
FT                   LLSGTAFTAPRHENRRTWLYRRQPSVVSGRYQPYAQPHWTTGGAREIALPPEPMRWHPM
FT                   PLDGAAEADFIDGMHTVAANGDAESQVGIGSLMYLAGRSMDKRAFVNADGEMLVVPQQG
FT                   RLVITTELGVLDVKPGEIAVLPRGMVFKVALPDGLSRGYVCENYGAHFRLPELGPIGSN
FT                   GLANARDFQAPVAAFEEDGGAYELVKKFAGRFWKAPTKQSPFNVVAWHGNLAPVKYDTA
FT                   RFMAIGSISFDHPDPSIFTVLTSPSDTPGTANCDFVIFPPRWMVMENTFRPPWFHRNLM
FT                   SEFMGLVLGEYDAKPGGFKPGGASLHNCMVPHGPDEEAFDKATHADLKPHKLDNTLAFM
FT                   FESRFRFIPTNFALKSPALDTDYADCWAGLKDQFKP"
     atgaccgaca ttcccgccac cgaacggcgc tacctcggcg gcttcggcaa cgaatacgcc        60
     tccgaagctg tgcctggcgc cctgccgcag ggccgcaaca acccgcagcg cgggcccttc       120
     gatctctaca ccgaactgct ctcgggcacc gccttcaccg cgccgcgcca tgagaaccgc       180
     cgcacctggc tctaccgccg ccagccctcg gtggtgtcag gccgctacca gccctacgca       240
     cagccgcact ggacgaccgg tggcgcccgc gagatcgcgc tgccgcccga gccgatgcgc       300
     tggcacccga tgccgctcga tggcgcggcc gaggccgact tcatcgacgg catgcacacg       360
     gtcgcggcga acggcgatgc cgaatcgcag gtcggcatcg gctcgctgat gtacctggcc       420
     ggccgctcga tggacaagcg cgccttcgtc aacgccgacg gcgagatgct ggtcgtgccg       480
     cagcaaggcc gcctcgtcat cacgacggaa ctcggcgtgc tcgacgtgaa gcccggcgaa       540
     atcgcggtgc tgccgcgcgg catggtcttc aaggtggcgc tgccggacgg tctctcgcgc       600
     ggctacgtct gcgagaacta cggcgcgcat ttccggctgc ccgagctggg tcccattggc       660
     tcgaacggcc tcgcgaacgc gcgcgatttc caggcacccg tggcggcgtt cgaggaagac       720
     ggcggcgcct atgaactggt caagaaattc gccggccgct tctggaaagc gccgacgaag       780
     cagtcgccct tcaacgtggt cgcctggcac ggcaacctcg cgccggtgaa gtacgacacg       840
     gcgcgcttca tggccatcgg ctcgatcagc ttcgaccatc ccgatccgtc gatcttcacc       900
     gtgctgacat cgcccagcga cacgcccggc accgccaact gcgacttcgt gatcttcccg       960
     ccgcgatgga tggtgatgga gaacaccttc cgtccgccct ggttccaccg caacctcatg      1020
     agcgagttca tgggcctggt gctcggcgaa tacgacgcca agccgggcgg cttcaagccc      1080
     ggcggcgcga gcctgcacaa ctgcatggtg ccgcacggcc cggacgagga agccttcgac      1140
     aaggcgacgc acgcggacct caagccccac aagctggaca acacgctggc cttcatgttc      1200
     gagagccgct ttcgcttcat tccgacgaac ttcgcgctga agagcccggc gctcgacacc      1260
     gactacgccg actgctgggc ggggctgaag gaccagttca agccatga                   1308
//

If you have problems or comments...

PBIL Back to PBIL home page