(data stored in ACNUC1104 zone)

EMBL: CP002417.PE30

CP002417.PE30        Location/Qualifiers
FT   CDS_pept        33888..34832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0030"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0028 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34253"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXQ9"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0028"
FT                   /protein_id="ADU34253.1"
FT                   /translation="MTPSETKAIVTLSLLAAFVDGEKHERERAEIKRIAEGLSQADGLN
FT                   LPTLYQDVLMKRVSLASVAGELTSSESKQLAYEMAVCVCDADGAQSEAERMFLADVRTS
FT                   LGLDASAARFSEQAEEIAAVPVAAAAGTAVASVAAPNVPDSAELDKSILNASILNGALE
FT                   LLPETLSTMAIIPLQMKLVYRIGQAHGYQLDSGHIKDFLATVGVGLTSQYLEQAGRKLL
FT                   GGLLGKMGGGLLRGLGNQAVSSGMSFASTYALGHVAKRYYGGGRTLSTQMLKDAFSGVV
FT                   KEGQSLQTQYLPAIQEKARTLDAGKVLSLVRGA"
     atgacacctt cagaaaccaa ggccatcgtg accctgagcc tgctggctgc ctttgtcgac        60
     ggcgagaaac acgagcgcga gcgcgccgag atcaagcgca ttgcggaggg cctgtcgcaa       120
     gccgacgggt tgaacctgcc gacgctctac caggacgtgc tgatgaagcg cgtgtcgctg       180
     gcctcggtgg cgggtgagct gaccagcagc gaatcgaagc aactcgccta tgaaatggcg       240
     gtgtgcgtgt gcgacgccga tggcgcgcaa tcggaagcgg agcgcatgtt cctcgcggat       300
     gtgcgcacct cgctcggtct ggatgcctcg gcggcgcggt tttcagagca ggcggaagaa       360
     attgccgcgg tgcctgtcgc ggctgcagcg ggaactgccg tggcttcggt tgccgcgccc       420
     aacgtgccgg acagcgccga gctcgacaag tcgatcctca acgcctccat cctcaacggc       480
     gcgctcgagc tcttgcccga gacgctctcg accatggcga tcattccgct gcagatgaag       540
     ctggtctacc gcatcggcca ggcgcacggt taccagctcg acagcggcca catcaaggat       600
     ttcctcgcca ccgtgggtgt gggcctgacc tcgcagtacc tggagcaagc cgggcgcaag       660
     ctgctcggcg gtctgctcgg aaagatgggc ggcggcctgc tgcgcgggct gggcaaccag       720
     gccgtgagtt cgggcatgag cttcgcgtcg acctacgccc tcggccatgt ggccaagcgc       780
     tattacggcg gcgggcgcac cctctcgacg cagatgctca aggatgcgtt ttcgggcgtg       840
     gtgaaggaag ggcagagcct gcagacgcaa tatctgccgg ccattcaaga gaaggcccgc       900
     acgctggatg cgggcaaggt gctgtcgttg gtgcgcggcg cctga                       945
//

If you have problems or comments...

PBIL Back to PBIL home page