(data stored in ACNUC1104 zone)

EMBL: CP002417.PE300

CP002417.PE300       Location/Qualifiers
FT   CDS_pept        complement(317207..318928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0301"
FT                   /product="monooxygenase FAD-binding protein"
FT                   /note="PFAM: monooxygenase FAD-binding; KEGG:
FT                   vap:Vapar_0291 FAD-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34523"
FT                   /db_xref="GOA:E6V292"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6V292"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /protein_id="ADU34523.1"
FT                   /translation="MIDYQSLRFDYRRHADQDAAPPAHHPVVIVGAGPVGLTLAIDLAL
FT                   RQVPVVLLDNDNTLSSGSRAICFAKRSLEVFDRLGCGDRMVDKGVSWSVGKVFFHDEQV
FT                   YRFDLLPEPGHERPAFINLQQYYVEGYLVERAAALPLIDLRWNNKVTGIEQRDEGAVLT
FT                   VETPEGNYQLAAGYVAACDGSRSNLRQLLGQEAKGRTFRDRFLIADITMDAGPPPGRPK
FT                   ADAPPSGGQRGHEVPSVGGDILPTERRFWFDPSFHPGQSVLLHKQADGMWRVDFQLGWD
FT                   ADPVEERKPENITPRVRALLDSIGFADVQFQIGWASVYTFACQRMERFRHGRVLFAGDS
FT                   AHGVSPFGARGANSGVQDADNLAWKLAAVLKGDAPDALLDSYASEREYAADENIRHSTR
FT                   ATDFITPKSEVSRLFRDAVLELTKRHAFARTLVNSGRLSVPAVLRDSPLNTVDADAFKG
FT                   AMVPGAAAADAPAVRADGSTGWLLRECHGQQFTALVFGAGEAAERSAEVLKAFDAPLHI
FT                   VRVQGTTPEGELATQRYDAQPGTVYLLRPDQHVCARWRQPTPANIRAAIDRALARA"
     gtgatcgact atcaaagtct gcgcttcgac taccgccgcc acgccgacca ggacgcagcg        60
     ccccccgctc atcaccccgt tgtgatcgtc ggtgccggcc cggtcggcct cacgctcgcc       120
     atcgacctcg cgctgcgcca ggtgcctgtc gtgctgctcg acaacgacaa caccctctcc       180
     agcggctcgc gcgcgatctg ctttgccaag cgctcgctcg aagtgttcga ccgcctcggc       240
     tgcggcgacc gcatggtcga caagggcgtc tcgtggagcg tgggcaaggt gttcttccac       300
     gacgagcagg tctaccgctt cgacctgctg cccgagcccg gccatgagcg gcccgcgttc       360
     atcaacctgc agcagtacta cgtcgagggc tacctcgtcg aacgtgccgc cgcgctgccg       420
     ctgatcgacc tgcgctggaa caacaaggtg acgggcatcg aacagcgcga cgaaggcgcg       480
     gtgctcacgg tcgagacgcc cgaaggcaac tatcaactag cggccggcta cgtcgccgcc       540
     tgcgatggct cgcgttccaa cctgcgccag ctgctcggcc aggaggccaa gggccgcacc       600
     ttccgcgacc gcttcctgat cgccgacatc acgatggatg ccggtccgcc gccgggccgc       660
     cccaaggcgg acgcgccccc ctcggggggg cagcgaggac acgaagtgcc gagcgtgggg       720
     ggcgacattc tccccaccga gcgccgcttc tggttcgacc cctccttcca cccgggccag       780
     agcgtgctgc tgcacaagca ggcagatggc atgtggcgcg tcgacttcca gctcggctgg       840
     gacgccgacc cggtggaaga gcgcaagccc gagaacatca cgccgcgggt gcgcgcgctg       900
     ctcgacagca tcggttttgc ggacgtgcag ttccagatcg gctgggccag cgtctacacc       960
     ttcgcctgcc agcgcatgga gcgctttcgc cacggccgcg tgctgttcgc gggcgactcg      1020
     gcgcacggcg tgtcgccctt cggcgcgcga ggcgccaact cgggcgtgca ggacgcggac      1080
     aacctcgcgt ggaaacttgc tgccgtgctg aagggcgatg cgcccgatgc actgctcgac      1140
     agctacgcga gcgagcgcga atacgcggca gacgaaaaca tccgccactc cacgcgtgcg      1200
     accgacttca tcacgcccaa gagcgaggtg agccgcctgt tccgcgacgc ggtgctggaa      1260
     ctgaccaagc gccatgcgtt cgcgcgcacg ctggtcaaca gcgggcggct ctcggtgccg      1320
     gcggtgctgc gcgattcgcc gctcaacacg gtcgatgccg acgccttcaa gggcgctatg      1380
     gtgccgggcg ctgccgcggc cgatgcgccg gccgtgcgag ccgacggaag caccggctgg      1440
     ctgctgcgcg aatgccatgg ccagcagttc actgcactgg tcttcggcgc gggcgaagcc      1500
     gccgagcgca gtgcagaggt gctgaaggct ttcgacgcgc cgctgcacat cgtgcgcgtg      1560
     caaggcacga cgcccgaagg cgaactcgcc acccagcgct acgacgcgca acccggtacc      1620
     gtctacctgc tgcggcccga ccagcatgtg tgcgcgcgct ggcggcaacc cacacctgcg      1680
     aacatccgtg cggccatcga ccgcgcactg gcaagagcat ga                         1722
//

If you have problems or comments...

PBIL Back to PBIL home page