(data stored in ACNUC1104 zone)

EMBL: CP002417.PE301

CP002417.PE301       Location/Qualifiers
FT   CDS_pept        complement(319075..320034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0302"
FT                   /product="beta-lactamase domain protein"
FT                   /note="KEGG: vap:Vapar_0292 beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34524"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E6V293"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0292"
FT                   /protein_id="ADU34524.1"
FT                   /translation="MSQAKKFASQADMEEKKITFSQISEHAWAYTAEGDPNTGIVIGDD
FT                   CVLVADTQATPAMAADVVRRIREVTDKPIKYVVLTHYHAVRVLGAAGYGAEHILASQDT
FT                   RDLIVERGEADKASEIGRFPRLFQNVETVPPGLTWPTMTFAGKMTLWLGKLEVQLIQLG
FT                   RGHTKGDTVVWLPGEKTLLSGDLVEFGATPYAGDAYFQDWPQTLDNIAALQPAALVPGR
FT                   GAALTTPAEVAEGLTGTRNFISDVYASVQEGVKAGRDLNTVYKDTYAKLKPKYSQWVIF
FT                   DHCMPFDVSRAYDEASGHADPRVWTAERDIEMWKALEG"
     atgagccaag ccaagaagtt cgccagccag gccgacatgg aagaaaagaa gatcaccttc        60
     agccagatct cggagcacgc ctgggcctac accgccgagg gcgacccgaa caccggcatc       120
     gtgatcggcg acgactgcgt gctggtcgcc gacacgcaag ccacccccgc catggccgcc       180
     gacgtggtgc ggcgcatccg cgaagtgacc gacaagccca tcaagtacgt ggtgctcacc       240
     cattaccacg cggtgcgcgt gctgggcgcg gcgggctacg gggccgagca catcctggcc       300
     agccaggaca cgcgcgacct gatcgtggag cgcggcgagg ccgacaaggc cagcgaaatc       360
     ggccgcttcc cgcgcctgtt ccagaacgtc gagaccgtgc ccccgggcct gacctggccc       420
     accatgacct tcgccggcaa gatgacgctg tggctcggca agctcgaggt gcagctgatc       480
     cagctgggcc gcggccacac caagggcgac acggtcgtct ggctgccagg cgagaagacg       540
     ctgctgtcgg gagacctggt ggagttcggc gccacgccgt atgccggcga cgcctacttc       600
     caggactggc cgcagacgct ggacaacatc gcagccctcc agcccgccgc actggtgccg       660
     ggccgcggcg cggcgctcac cacgccggcc gaagtggccg agggcctcac cggcacacgc       720
     aacttcatct ccgacgtgta tgcgagcgtg caggaaggcg tgaaggcagg ccgcgacctg       780
     aacacggtct acaaggacac ctacgcgaag ctcaagccca agtacagcca gtgggtgatc       840
     ttcgaccact gcatgccgtt cgacgtgagc cgcgcgtacg acgaggcctc gggccacgcc       900
     gatccgcgcg tgtggacggc cgagcgggac atcgagatgt ggaaggcgct ggaaggctga       960
//

If you have problems or comments...

PBIL Back to PBIL home page