(data stored in SCRATCH zone)

EMBL: CP002417.PE302

CP002417.PE302       Location/Qualifiers
FT   CDS_pept        320183..321088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0303"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="KEGG: vap:Vapar_0293 transcriptional regulator, IclR
FT                   family; PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34525"
FT                   /db_xref="GOA:E6V294"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6V294"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ADU34525.1"
FT                   /translation="MTKDSSHTGDSSDPPETDRSAQRGIQSIEVGGQLLRALVHHGRPM
FT                   ALKDLAREAEMTPAKAHPYMVSFGRLGLIEQDRASGHYLLGPLALQLGLISLQQADPVH
FT                   IATPLLSPLALQIGHTVALAVWGARGATIVRTAESPSPVHVTMRHGTVFSLTNTASGRI
FT                   FAAYLDADAVRQLLEEERQRQKPRKGAAAEPAAPAGGMPAVQPLPSWSDFERQLKEVRA
FT                   HGISRSDGEVIKGVSAMAAPVFDHTGAIVLAVTAIGPAGVFDTAWDGELSRALKACAGA
FT                   VSQRLGAPAAGPSGSSKPER"
     gtgaccaagg actccagcca caccggcgac agcagcgacc cccccgagac cgaccgctcc        60
     gcccagcgcg gcatccagag catcgaggtc ggcggccagt tgctgcgtgc gctggtgcac       120
     cacggcaggc cgatggcgct gaaggacctg gcgcgcgagg ccgaaatgac gcccgccaag       180
     gcccacccct acatggtgag cttcggacgg ctcgggctca tcgagcagga ccgcgccagc       240
     ggccactatc tgctcggtcc gctggccttg caactggggc tcatcagcct gcagcaggcc       300
     gatccggtgc acatcgccac cccgctgctc agcccgctgg cgctgcagat cggccacacg       360
     gtggcgctgg cggtgtgggg cgcgcgcggc gcgaccatcg tgcgcacggc cgaatcgccg       420
     tcgccggtgc atgtgaccat gcggcacggc acggtgttct cgctgaccaa caccgcttcg       480
     ggccgcatct tcgcggccta cctcgatgcc gacgcggtgc ggcaactgct cgaagaggag       540
     cgccagcgcc agaaaccgcg caagggcgca gccgccgagc ccgctgcacc cgccggcggc       600
     atgccggccg tgcagccgct gccgtcgtgg agcgacttcg agcgtcaact caaagaagtg       660
     cgcgcacacg gcatcagccg ctccgacggc gaggtgatca agggcgtgag cgccatggcc       720
     gcgccggtgt tcgaccacac cggcgccatc gtgctggccg tgaccgcgat cggcccggcc       780
     ggcgttttcg acaccgcgtg ggacggcgag ctttcacgcg cactcaaggc ctgtgcgggc       840
     gccgtgtcgc agcggctcgg cgcgcccgcc gcgggacctt ccggatcttc gaaacctgag       900
     cgatga                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page