(data stored in ACNUC1104 zone)

EMBL: CP002417.PE303

CP002417.PE303       Location/Qualifiers
FT   CDS_pept        321085..321840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0304"
FT                   /product="Silent information regulator protein Sir2"
FT                   /note="PFAM: Silent information regulator protein Sir2;
FT                   KEGG: vap:Vapar_0294 silent information regulator protein
FT                   Sir2"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34526"
FT                   /db_xref="GOA:E6V295"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:E6V295"
FT                   /inference="protein motif:PFAM:PF02146"
FT                   /protein_id="ADU34526.1"
FT                   /translation="MTRPDATDTTSISSPLAAAIALLRDARRIVVFSGAGLSRASGIPT
FT                   YRDADGLWKSQNALQFSHAEDLKRDPAGFTKFWGQRMSVVESATPNPGHRALAQLQRLR
FT                   PATRLVTQNVDGLLTQAGGLDVLELHGSLRRWRCDHCGNRSGPWPFHRCLRCGSHARPD
FT                   VVMFGEMLNPGVLLEAQVAAQESDLFMVVGSTTIVYPAAELPELAMARGSRLITLNLEP
FT                   LPHLDDSAAVVLRGTSEDLLPRLLAGLGG"
     atgacgcgac ccgacgccac cgacaccacc tctatctctt ccccgctggc agccgccatc        60
     gcgctgctcc gcgacgcccg gcgcatcgtc gtcttctcgg gcgccggctt gtcccgcgcc       120
     tcgggcatcc cgacctaccg cgatgccgac ggcctctgga aaagccagaa cgccctgcag       180
     ttttcccatg ccgaagacct caagcgcgac cctgcgggct tcacgaagtt ctgggggcag       240
     cgtatgtcgg tcgtcgaatc ggccacaccc aatccggggc accgggcgct cgcgcagttg       300
     cagcggctgc gcccggcgac gcggctggtc acgcagaacg tcgatgggct cctcacccag       360
     gcgggcgggc tcgacgtgct cgaactgcac ggatcgctgc gccgctggcg ctgcgatcac       420
     tgcggcaacc gcagcggccc ctggcccttt caccggtgcc tgcgctgcgg ctcgcatgcg       480
     cggcccgacg tcgtgatgtt cggcgagatg ctcaaccccg gcgtgctgct cgaggcccag       540
     gtggcggcgc aggagtcgga cctcttcatg gtggtcggca gcacgaccat cgtctatccg       600
     gcggccgaac tgcccgagct ggcgatggcg cgcggcagcc ggctcatcac gctgaacctg       660
     gagccgctgc cgcacctgga cgattcggcg gcggtggtgc tgcgcgggac ttcggaagac       720
     ctgttgccgc gcttgctggc agggctgggc ggctag                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page