(data stored in ACNUC1104 zone)

EMBL: CP002417.PE304

CP002417.PE304       Location/Qualifiers
FT   CDS_pept        complement(321859..322353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0305"
FT                   /product="pentapeptide repeat-containing protein"
FT                   /note="KEGG: vap:Vapar_3355 pentapeptide repeat-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34527"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:E6V296"
FT                   /inference="similar to AA sequence:KEGG:Vapar_3355"
FT                   /protein_id="ADU34527.1"
FT                   /translation="MSSLQIIQDHDKWRKGTGGAPAGLAGESDGNVYLGLDLGLITFTS
FT                   STFKSSRFGTTSFVDAVWTACRFTGCSFSRCDMQRIKVNGCSFVGCTFAASQLRASIFS
FT                   DCTFSHCNLISLNFDASHWSRVKLLDCRGQQVSAADLVGEQVDFTGSRFEDMQFTNARI
FT                   N"
     atgagctctc ttcagatcat ccaggaccac gacaaatggc gcaaaggcac gggcggcgcg        60
     cccgcgggac tggcgggtga aagcgacggc aatgtctacc tcggcctcga tctcggcctg       120
     atcaccttca cgtccagcac cttcaagagc agccgcttcg gcaccaccag cttcgtggat       180
     gccgtgtgga ccgcgtgccg cttcaccggc tgctcgttca gccggtgcga catgcagcgg       240
     atcaaggtca acggctgttc attcgtgggc tgcaccttcg cggcatcgca actcagggcc       300
     agcatcttca gcgactgcac gttcagtcac tgcaacctca tctcgctgaa tttcgatgcg       360
     agccactggt cccgggtcaa gctgctcgat tgccggggcc agcaagtgag cgccgccgac       420
     ctcgtcggcg agcaggtgga cttcacggga agccggttcg aggacatgca gttcaccaac       480
     gcgcgcatca actga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page