(data stored in ACNUC1104 zone)

EMBL: CP002417.PE305

CP002417.PE305       Location/Qualifiers
FT   CDS_pept        complement(322536..322757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0306"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0295 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34528"
FT                   /db_xref="GOA:E6V297"
FT                   /db_xref="UniProtKB/TrEMBL:E6V297"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0295"
FT                   /protein_id="ADU34528.1"
FT                   /translation="MNATRIVGILLIVAGIAGLGLGGFSFTKETHQAKLGPLEFSVKEK
FT                   QTVNFPAWAGVAAIVVGGALVLLGGKKS"
     atgaacgcaa cacgcatcgt cggcatcctg ctgatcgtgg caggcatcgc ggggctgggc        60
     ctcggcggct tcagcttcac caaggaaacg caccaggcca agctcgggcc gctggagttc       120
     tcggtgaagg aaaagcagac cgtcaacttc ccggcctggg ccggcgtggc cgccatcgtg       180
     gtgggcggcg cgctggtgct gctgggcggc aagaagagtt ga                          222
//

If you have problems or comments...

PBIL Back to PBIL home page