(data stored in ACNUC1104 zone)

EMBL: CP002417.PE308

CP002417.PE308       Location/Qualifiers
FT   CDS_pept        complement(324471..325328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0309"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: vap:Vapar_0298 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34531"
FT                   /db_xref="GOA:E6V2A0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2A0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU34531.1"
FT                   /translation="MNTAVNNSSSSSDPTVVDIRKLWTVFKNADGEQVVHRDLNMHIDR
FT                   GEVLSLVGGSGTGKTVLLRQILGLEKPTQGVVEVLGQQPGELSASGAANVGMLFQHGAL
FT                   FSAFSVLENIAFPLRELKLLPDELIRHAALVKLQMVGLEPQHANKSPSDLSGGMIKRVA
FT                   LARALIMDPPLLLLDEPTAGLDPEASDSFCNLLRGLHRELGLTVVMVTHDLDTLFDLST
FT                   RIAVLADQKVIVSGTAREVIAYPHPFIHEYFLGGRGQRALEALHDKPATEQHAPRPEAA
FT                   RAER"
     atgaataccg ccgtgaacaa cagcagcagc agcagcgacc ccaccgtcgt cgacatccgc        60
     aagctctgga cggtattcaa gaacgccgac ggcgagcagg tggtgcatcg cgatctcaac       120
     atgcatatcg accggggcga ggtgctctcg ctggtgggcg gctcgggcac cggcaagacg       180
     gtgctgctgc gccagatcct cggactggaa aagccgacgc agggcgtggt cgaggtgctg       240
     ggccagcagc cgggcgaact cagcgcctcg ggcgcggcca acgtgggcat gctgttccag       300
     cacggcgcgc tgttctcggc cttcagcgtg ctggagaaca tcgcctttcc gctgcgcgaa       360
     ttgaagctgc tgcccgacga gctgatccgc cacgcggcgc tcgtgaaact gcagatggtc       420
     gggctggagc cgcagcatgc gaacaagagc ccgtcggacc tgtcgggcgg catgatcaag       480
     cgcgtggcgc tggcgcgcgc gctcatcatg gacccgccgc tgctgctgct cgacgagccc       540
     accgcgggcc tggaccccga ggcttccgac agcttctgca atctgctgcg cggcctgcac       600
     cgcgagctgg gcctgacggt ggtgatggtc acgcacgacc tggacacgct gttcgacctg       660
     agcacccgca tcgcggtgct ggccgaccag aaagtcatcg tcagcggcac ggcgcgcgag       720
     gtcatcgcct acccgcatcc gttcatccac gaatactttc taggagggcg cggccagcgc       780
     gccctggagg cgctgcatga caagccagcc acagaacaac acgcgccgcg gcccgaagcc       840
     gcgcgcgccg aaaggtag                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page