(data stored in ACNUC1104 zone)

EMBL: CP002417.PE309

CP002417.PE309       Location/Qualifiers
FT   CDS_pept        complement(325325..326491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0310"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   vap:Vapar_0299 protein of unknown function DUF140"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34532"
FT                   /db_xref="GOA:E6V2A1"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2A1"
FT                   /inference="protein motif:PFAM:PF02405"
FT                   /protein_id="ADU34532.1"
FT                   /translation="MPSATQTADAPAADSAWPRVAQQEQEGRQWTVATGRWTALGMSSL
FT                   PAWQALSKSLAAAPPADDRAWDLRPIEQLDHIGAQLLWEHWRHEWPATLEMEAQHKAVL
FT                   DQVAQYTVATPVEPPKTLADRIRTFSHNGPRAMVVARDFIGLIGQLAIDVGTLIRAPHR
FT                   APWRDFSGHLYQFGATALHITALVGLLIGVVLAYLISQQLRNYGAEAFVVNILGLSLVR
FT                   ELGPVLAAVLIAGRSGSAITAQIGVMRVTEELDAMRVMGIPHGFRLVMPRVLALAIAMP
FT                   LISLWTSMAALLGGMLAADAALDISPAYFLSALPRAVPIANLWLAMAKSAVFGILIALI
FT                   GCYFGMKVKPNTESLGRGTTSSVVTSITAVILVDALFAVLFKGIGFRG"
     atgccttccg ccacccagac tgccgacgcc ccagccgccg acagcgcgtg gccgcgtgta        60
     gcgcagcagg agcaggaagg ccgtcaatgg acggtggcca ccggccgctg gaccgcgctg       120
     ggcatgtcgt cgctgccggc ctggcaggcg ctctccaaaa gcctggcggc ggcacctccc       180
     gcggacgacc gcgcctggga cctgcgcccc atcgagcagc tcgaccacat cggcgcccag       240
     ctcctgtggg agcactggcg ccacgaatgg cccgccacgc tggagatgga agcgcagcac       300
     aaggcggtgc tcgaccaggt ggcgcagtac accgtcgcca cgccggtcga accgcccaag       360
     acgctggccg accgcatccg caccttctcg cacaacgggc cgcgcgcgat ggtcgtggcg       420
     cgcgatttca tcgggctgat cggccagctc gcgatcgatg tcggcacgct gatccgtgcc       480
     ccgcaccgcg cgccgtggcg cgacttctcg ggacatcttt atcagttcgg cgcgacggcg       540
     ctgcacatca cggcgctggt cggcctcttg atcggcgtgg tgctggccta cctgatctcc       600
     cagcagctgc gcaactacgg cgccgaggcc ttcgtggtca acatcctcgg gctctcgctg       660
     gtgcgcgaac tcgggccggt gctggccgcg gtgttgatcg ccgggcgctc gggatcggct       720
     atcaccgcgc agatcggcgt gatgcgggtg accgaggaac tcgacgcgat gcgcgtcatg       780
     ggcattccgc acggctttcg cctcgtgatg ccgcgcgtgc tggcgctggc catcgcgatg       840
     ccgctcatca gcctgtggac ctcgatggcg gcgctgctgg gcggcatgct cgcggccgac       900
     gcggcgctcg acatttcgcc ggcctacttt ctttcggcgc tgccgcgcgc ggtgccgatt       960
     gccaacctgt ggctcgcgat ggccaagtcg gccgtgttcg gcatcctgat cgctctgatc      1020
     ggctgctact tcggcatgaa ggtcaagccc aacaccgaaa gcctcgggcg cggcacgacc      1080
     tcgtcggtgg tgacctcgat caccgcggtg atcctggtcg acgcgctgtt cgcggtgctg      1140
     ttcaaaggca tcggattccg gggatga                                          1167
//

If you have problems or comments...

PBIL Back to PBIL home page