(data stored in ACNUC1104 zone)

EMBL: CP002417.PE31

CP002417.PE31        Location/Qualifiers
FT   CDS_pept        complement(34834..35235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0031"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="TIGRFAM: Cu(I)-responsive transcriptional regulator;
FT                   PFAM: Transcription regulator MerR DNA binding; regulatory
FT                   protein MerR; KEGG: vap:Vapar_0029 transcriptional
FT                   regulator, MerR family; SMART: regulatory protein MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34254"
FT                   /db_xref="GOA:E6UXR0"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011789"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXR0"
FT                   /inference="protein motif:TFAM:TIGR02044"
FT                   /protein_id="ADU34254.1"
FT                   /translation="MTVQVAIGEAARLSGVSARMVRHYEGLGLLPAVARTDSGYRQYSE
FT                   ADVHTLRFIKRSRDLGFSMEEIAELVGLWHNRRRASSSVKRVAEKHLGELEQRIADMQS
FT                   MRNTLAHLVHCCHGDARPDCPILDDLGKA"
     atgacggtcc aggtcgccat cggcgaagcc gcacgcctct ctggcgtgtc ggcgcgcatg        60
     gtccggcact acgaggggct gggccttttg ccggcggtgg cgcgcaccga cagcggttac       120
     cggcaataca gcgaggccga cgtgcacacg ctgcgcttca tcaagcgctc gcgcgacctc       180
     ggtttttcaa tggaagaaat cgccgagctg gtgggcctct ggcacaaccg ccggcgcgcg       240
     agttcgagcg tcaagcgggt tgcggaaaag cacctgggag aactggagca gcgcatcgcg       300
     gacatgcagt cgatgcgcaa cacgctcgcg cacctcgtgc attgctgtca cggcgatgcg       360
     cgcccggact gcccgatcct cgacgacctg ggcaaagcct ag                          402
//

If you have problems or comments...

PBIL Back to PBIL home page