(data stored in ACNUC1104 zone)

EMBL: CP002417.PE311

CP002417.PE311       Location/Qualifiers
FT   CDS_pept        327628..329145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0312"
FT                   /product="methylmalonate-semialdehyde dehydrogenase"
FT                   /note="KEGG: vap:Vapar_3271 methylmalonate-semialdehyde
FT                   dehydrogenase; TIGRFAM: methylmalonate-semialdehyde
FT                   dehydrogenase; PFAM: Aldehyde Dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34534"
FT                   /db_xref="GOA:E6V2A3"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2A3"
FT                   /inference="protein motif:TFAM:TIGR01722"
FT                   /protein_id="ADU34534.1"
FT                   /translation="MSMNIRNIDHYIAGLPAANASGRTQDVTNPATGAVTGKVGLADAA
FT                   QVSAAVAAAQAAFPAWADTPPIRRARVMFKFLQLLNEHKDELAHLITAEHGKVFTDAQG
FT                   EVSRGIDIVEFACGIPQLLKGDFTDQVSTGIDNWTLRQPLGVVAGITPFNFPVMVPMWM
FT                   FPVAIAAGNTFVLKPSPTDPSPSLLIAELFKQAGLPDGVFNVVQGDKVAVDALLEHPDV
FT                   KAISFVGSTPIANYIYETGAHHGKRVQALGGAKNHMVVMPDADIDQTVDALIGAGYGSA
FT                   GERCMAISVAVLVGDVADKVIPKLIERTKTLKVLNGTNLAAEMGPIVTRAAHERITGYI
FT                   AQGEKEGAKLLVDGRSFDGSVAGEGCGDGFWMGGTLFDHVTPEMRIYKEEIFGPVLSCV
FT                   RVENFKDAVDLINAHEFGNGVSCFTRDGNVAREFSRRIQVGMVGINVPIPVPMAWHGFG
FT                   GWKKSLFGDMHAYGEEGVRFYTKQKSIMQRWPESIGKGAEFVMPTAK"
     atgtccatga atatcagaaa tatcgatcat tacatcgccg gcctgccggc cgccaacgcc        60
     tcgggccgca cgcaggacgt gacgaacccc gccacgggcg ccgtcaccgg caaggtcggc       120
     ctcgccgacg ccgcgcaggt ctcggccgcc gtggccgccg cccaggccgc cttccccgcc       180
     tgggccgaca ccccgccgat ccgccgggcg cgcgtgatgt tcaagttcct gcagttgctc       240
     aacgagcaca aggacgagct cgcccacctc atcaccgccg agcacggcaa ggtcttcacc       300
     gacgcgcagg gcgaggtcag ccgcggcatc gacatcgtcg aattcgcctg cggcatcccc       360
     caactcctca agggcgactt caccgaccag gtgagcaccg gcatcgacaa ctggacgctg       420
     cgccagccgc tgggcgtggt cgccggcatc acgcccttca acttcccggt gatggtgccg       480
     atgtggatgt tcccggtggc cattgccgcg ggcaacacct tcgtgctcaa gcccagcccg       540
     accgacccga gcccgtcgct gctgatcgcc gaactgttca agcaggccgg cctgcccgat       600
     ggcgtgttca acgtcgtgca gggcgacaag gtcgcggtcg atgcgctgct cgagcacccc       660
     gacgtcaagg ccatcagctt cgtgggctcc acgccgattg ccaactacat ctacgaaacc       720
     ggcgcgcacc acggcaagcg cgtgcaggcc ctcggcggcg cgaagaacca catggtcgtc       780
     atgcccgacg ccgacatcga ccagaccgtg gatgcgctga tcggcgcggg ctacggctcg       840
     gcgggcgagc gctgcatggc gatcagcgtc gcggtgctgg tgggcgacgt ggcggacaag       900
     gtgattccga agctcatcga gcgcacgaag acgctcaagg tcttgaacgg caccaacctc       960
     gcggccgaga tgggcccgat cgtcacgcgc gcggcgcacg agcgcatcac cggctacatc      1020
     gcgcaaggcg agaaggaagg cgcgaagctg ctggtcgatg gtcgttcgtt cgatggcagc      1080
     gtggctggcg aaggctgcgg cgacggcttc tggatgggcg gcacgctgtt cgaccacgtc      1140
     acgcccgaga tgcgcatcta caaggaagag atcttcggtc cggtgctcag ctgcgtgcgc      1200
     gtggagaact tcaaggacgc ggtggacctc atcaacgccc acgagttcgg caacggcgtg      1260
     agctgcttca cccgcgacgg caacgtggcg cgcgaattca gccggcgcat ccaggtgggc      1320
     atggtcggta tcaacgtgcc gattccggtg ccgatggcct ggcacggttt cggcggctgg      1380
     aagaagagcc tgttcggcga catgcacgcg tacggtgaag agggcgtgcg cttctatacg      1440
     aagcagaagt cgatcatgca gcgctggcca gagagcatcg gcaagggtgc cgagttcgtc      1500
     atgccgacgg ccaagtaa                                                    1518
//

If you have problems or comments...

PBIL Back to PBIL home page