(data stored in ACNUC1104 zone)

EMBL: CP002417.PE315

CP002417.PE315       Location/Qualifiers
FT   CDS_pept        complement(332539..333726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0316"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   vap:Vapar_0303 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34538"
FT                   /db_xref="GOA:E6V2A7"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2A7"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ADU34538.1"
FT                   /translation="MSSIRTLRTDVAIVGGGIVGSSAALALRQMGIGVALLERDLCGSR
FT                   SSGVNFGGVRRQGRPLSQLPLAQRAHRIWGRLPSLLDTDGEYLRSGHFKIARSESDMAS
FT                   LERYRAQSLDFDLGLELISAARLRERCPWLGPRAVGGSLCVEDGQANPRLVSPAFALAA
FT                   QRAGAQIFERHKVDEVAHDGAMFMLRSGNALEVHAPVLLNCAGAWAGPLAAQFGEAVPL
FT                   RASHPVMVVTEPLPHFMVWSLGVEGGGIYGRQVARGNLVLGGGRGYALDADRARVDRDA
FT                   IATLATQAIELLPALRHAHFIRTWSGTEGNMPDRQPVLGPSRTTPGLFHGFGFSGAGFQ
FT                   IGPAAGEVLAELVRDGHSSTPIDAFAVDRSFPEEDGEAADEEQTHSPLTSVPTLP"
     atgagttcga ttcggaccct gcgtaccgac gtcgccatcg tcggcggcgg catcgtcggt        60
     tcgtcggccg cgctcgcgct gcggcagatg ggcatcggcg tcgcgctgct ggagcgcgac       120
     ctctgcggct cgcgctccag cggcgtcaac ttcggcggcg tgcgacggca gggacgaccg       180
     ctgagccagt tgccgctcgc gcagcgcgcg catcggatat ggggccgcct gccgtcgctg       240
     ctcgacaccg atggcgagta cctgcgctcg gggcacttca agatcgcgcg cagcgaatcc       300
     gacatggcct cgctcgagcg ctatcgcgcg cagagcctgg acttcgacct cgggctcgaa       360
     ctgatctccg ccgcccgcct gcgcgagcgc tgcccctggc tcggcccgcg cgcggtcggc       420
     ggctcgctgt gcgtggaaga cgggcaggcc aacccgcggc tggtgtcgcc cgctttcgcg       480
     ctcgcggcgc agcgcgcggg cgcgcagatt ttcgagcgcc acaaggtcga cgaggtggcg       540
     cacgacggcg cgatgttcat gctgcgctcg ggcaatgcgc tcgaagtgca tgcgccggtg       600
     ctgctcaact gcgcgggcgc gtgggccggc cccctcgccg cccagttcgg cgaagcggtg       660
     ccgctgcgcg cgagccatcc ggtgatggtg gtgaccgagc cgctgccgca cttcatggtc       720
     tggagcctgg gcgtcgaggg cggcggcatc tacggccggc aggtggcgcg cggcaacctc       780
     gtgctcggcg gcggccgggg ctatgcgctc gatgccgacc gcgcgcgtgt cgatcgcgac       840
     gccatcgcca cgctcgcgac gcaggccatc gaactgctgc ccgcgctgcg ccatgcgcac       900
     ttcattcgca cctggagcgg caccgagggc aacatgcccg accgccagcc ggtgctcggc       960
     cccagccgca ccacgccggg tctgttccat ggcttcggct tctcgggcgc gggcttccag      1020
     atcggacctg ctgccggcga agtactggcc gagctggtgc gcgacggcca cagcagcacg      1080
     ccgatcgacg cgttcgcggt cgaccgctcc tttcccgaag aagacgggga agcagcggat      1140
     gaagaacaga cccactcccc tctcacttcc gttcccaccc ttccctga                   1188
//

If you have problems or comments...

PBIL Back to PBIL home page