(data stored in ACNUC1104 zone)

EMBL: CP002417.PE316

CP002417.PE316       Location/Qualifiers
FT   CDS_pept        complement(333723..335135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0317"
FT                   /product="BFD domain protein (2Fe-2S)-binding domain
FT                   protein"
FT                   /note="PFAM: BFD domain protein [2Fe-2S]-binding domain
FT                   protein; FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: vap:Vapar_0304 BFD domain protein
FT                   (2Fe-2S)-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34539"
FT                   /db_xref="GOA:E6V2A8"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR017224"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2A8"
FT                   /inference="protein motif:PFAM:PF04324"
FT                   /protein_id="ADU34539.1"
FT                   /translation="MTTNAGLQPVIVGAGPAGVRAAEALVAHGLRPLVIDEASRAGGQI
FT                   YRRPPANFIQRTAATLYGFEASRANAVHLAFDTLHDHIDYRPDSLVWNAQGGMLDVLHN
FT                   PTRTTTRVPHGALIVATGATDRVLPVPGWTLPGVYTLGGAQVALKFQGCAIGQRVVFMG
FT                   TGPLLYLVAYQYAKAGAKVAAVLDTARLADQIAATPAMLRQPAVFAKGVYFVAWLRAHG
FT                   VPLHSGVRPLRVIGDDEARRVTGVAWNDGREERTLACDAVGFGYALRSETQLADLLGCR
FT                   FEFAPMHRAHLPVRDAAGRASVEGVYLAGDGAGIMGADAAEWAGERAALALLADRGVAI
FT                   DAARAAALEAKLEGLMGFRRGLERAFPLPHDWAANAPDDLVVCRCENVTAGTLRQTIAV
FT                   NGADEMNRLKALSRVGMGRCQGRMCGVAAAEILAHATGQPLQQVGRLRGQAPIKPIPIQ
FT                   LAVHAASEGAGA"
     atgacgacga atgccgggct tcaacccgtg atcgtcggcg ccgggccggc cggtgtgcgc        60
     gcggcggagg cgctggtcgc gcatggactg cggcccctcg tgatcgacga ggcttcgcgg       120
     gccggtggac agatctaccg ccgcccgccc gccaacttca tccagcgcac ggcggccacg       180
     ctctacggct tcgaggcctc gcgcgcgaac gcggtgcacc tggccttcga cacactgcac       240
     gaccacatcg actaccgccc cgacagcctc gtgtggaacg cacagggcgg catgctcgac       300
     gtgctgcaca acccgacgcg caccacgacg cgcgtgccgc atggcgcgct gatcgtcgca       360
     acgggcgcga ccgaccgcgt gctgcccgtg ccgggctgga cgctgcccgg cgtctacacg       420
     ctcggcggcg cacaggtggc gctcaagttc cagggctgcg ccatcgggca gcgcgtggtg       480
     ttcatgggca ccgggccgct gctgtacctc gtggcttatc aatatgcaaa agccggcgcg       540
     aaggtcgcgg cggtgctcga caccgcgcgg ctcgcagacc agatcgcggc aacgcccgcg       600
     atgctgcgcc aaccggccgt gttcgcgaag ggcgtgtact tcgtcgcatg gttgcgtgcg       660
     cacggcgtgc cgctgcacag cggcgtgcgt ccgctgcgcg tgatcggcga cgacgaggcg       720
     cggcgtgtca ccggcgtcgc ctggaatgac ggccgcgaag agcgcacgct ggcctgcgat       780
     gccgtcggct tcggctatgc gctgcgctcc gagacgcaac tggccgacct gctcggctgc       840
     cgcttcgagt tcgcgcccat gcaccgcgcc cacctgccgg tgcgcgatgc ggcgggccgc       900
     gccagcgtcg aaggcgtgta cctcgcgggc gatggcgccg gcatcatggg tgccgatgcg       960
     gccgagtggg ccggcgagcg cgccgcgctc gcgttgctcg cggaccgcgg cgtggccatc      1020
     gacgccgcgc gcgccgctgc gctcgaggcc aagctcgaag gattgatggg ttttcgccgc      1080
     gggctggaac gcgcctttcc gctgccacac gattgggccg cgaacgcgcc cgacgacctt      1140
     gtcgtctgcc gctgcgagaa cgtcaccgcc ggcacgctgc gccagaccat tgctgtcaac      1200
     ggcgccgacg aaatgaaccg cctcaaggcg ctgtcgcgcg tcggcatggg ccgctgccag      1260
     ggccgcatgt gcggcgtggc agcggcagaa atcctcgcgc atgcgacggg ccagccgctg      1320
     caacaggtgg gccggctgcg cggacaggcg ccgatcaagc cgatcccgat ccaactcgcc      1380
     gtgcacgcgg ccagcgaagg agccggcgca tga                                   1413
//

If you have problems or comments...

PBIL Back to PBIL home page