(data stored in ACNUC1104 zone)

EMBL: CP002417.PE317

CP002417.PE317       Location/Qualifiers
FT   CDS_pept        complement(335132..335437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0318"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0305 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34540"
FT                   /db_xref="GOA:E6V2A9"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR042204"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2A9"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0305"
FT                   /protein_id="ADU34540.1"
FT                   /translation="MASTASHALLHRVAETGRAAVAFTLDGEPASALAGDTVLTAVLTQ
FT                   AGQLRRNEFSDMPRAGFCMMGACQDCWIATAEGERLRACSTFIAPGMALVTGRSGA"
     atggcatcga ctgcatcaca cgcactgctg catcgcgtag ccgagaccgg ccgcgcggcc        60
     gtggccttca cgctcgatgg cgagcccgct tcggcactcg ccggcgacac ggtgctcacg       120
     gccgtgctca cgcaggcagg ccaacttcgc cgcaacgaat tcagcgacat gccgcgcgcc       180
     ggcttctgca tgatgggcgc gtgccaggac tgctggatcg cgaccgccga aggcgaacgc       240
     ctgcgcgcct gctcgacctt catcgcgccg ggcatggcgc tggtcactgg gcggagcggc       300
     gcatga                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page