(data stored in ACNUC1104 zone)

EMBL: CP002417.PE318

CP002417.PE318       Location/Qualifiers
FT   CDS_pept        complement(335438..336232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0319"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: vap:Vapar_0306
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34541"
FT                   /db_xref="GOA:E6V2B0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2B0"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU34541.1"
FT                   /translation="MSKNGPFALAFNALVITFMLAPLLVVCIVAFTPENTLTIPTTSFS
FT                   LRWFAAVFAHPDFMQSFWNSLWLALASATIATLLAVPAGMAITRYEFPGRDFLNALFLS
FT                   PLIIPHLVLGVALLRLFALVGGTGSFGWLVMAHALIVTPYTLRLVVAALVGFDRSAEQA
FT                   ALSLGASQATVFRRITLPMILPGVTGGWMLAFINSFDEVTMSIFVTSPSTVTLPVRMYM
FT                   YATESIDPLMAAVSALMVAVTAIAMVILDRLYGLDRVLVGRK"
     atgagcaaga acggcccctt cgccctcgcg ttcaacgcac tcgtcatcac cttcatgctc        60
     gcgccgctcc tggtggtgtg catcgtcgcg ttcacgcccg agaacacgct gacgattccg       120
     accaccagct tctcgctgcg ctggttcgcc gcggtgttcg cgcaccccga cttcatgcag       180
     tcgttctgga acagcctgtg gctcgcgctg gcctcggcca ccatcgccac gctgctggcg       240
     gtgccagccg gcatggcgat cacgcgctac gagtttccgg ggcgcgactt cctcaatgcg       300
     ctgtttctct cgccgctgat cattccgcac ctggtcctgg gcgtggcgct cttgcggctc       360
     ttcgcgctgg tgggcggcac gggcagcttc ggctggctgg tgatggcgca tgcgctgatc       420
     gtcacgccct atacgctgcg cctcgtcgtc gccgcgctcg tgggcttcga ccgcagcgcc       480
     gagcaggcgg cgctctcgct cggcgcgagc caggcgacgg tattcaggcg catcacgctg       540
     ccgatgatcc tgccgggcgt cacgggcggc tggatgctcg ccttcatcaa cagcttcgac       600
     gaagtgacga tgtcgatctt cgtgacctcg ccgagcaccg tgacgctgcc ggtgcgcatg       660
     tacatgtatg cgaccgaatc gatcgatccg ctgatggcgg cggtgtcggc gctgatggtg       720
     gcggtgaccg ccatcgcgat ggtgatcctc gaccggctct acgggctgga ccgggtgctg       780
     gtgggacgca agtag                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page