(data stored in ACNUC1104 zone)

EMBL: CP002417.PE320

CP002417.PE320       Location/Qualifiers
FT   CDS_pept        complement(337094..338221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0321"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: vap:Vapar_0308 ABC transporter related; PFAM:
FT                   ABC transporter related; Transport-associated OB
FT                   domain-containing protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34543"
FT                   /db_xref="GOA:E6V2B2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2B2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU34543.1"
FT                   /translation="MACTKVSHAIFGSPTKGASMSFLRLTDVTKFYGSTRAVSAMNLSV
FT                   EKGEFVSLLGPSGCGKTTTLQMIAGFEAVSSGRIELAGKDITNAKANTRGLGIVFQSYA
FT                   LFPHMTVADNVSFGLEMRKMPKAERADRVKQALALVHLEPHATRYPRELSGGQRQRVAL
FT                   ARALVIEPPVLLLDEPLSNLDAKLREEMQFELRQIQRKVGTTTVMVTHDQSEAMSISDR
FT                   VVVMEGGCATQIDHPHRVYEHPSTRFISTFVGKANLLNGRVTACSTGSCNVEVGPLAVQ
FT                   VDEDGFKSGAAVLLSVRPEKLQLVTAGRGRLDGTVQERFFLGSQWLYRIATPAGDLMVL
FT                   SPNDGRDALDEGNAVGIDWPAHCTRLLPAEEAVAA"
     atggcctgca ccaaggtgtc gcacgccatc tttgggtctc ccacgaaagg cgcttccatg        60
     tcattcctac ggcttaccga cgtgaccaag ttctacggca gcacccgcgc ggtgtcggcg       120
     atgaacctca gcgtcgaaaa aggcgagttc gtctcgctgc tcggcccctc gggctgcggc       180
     aagaccacga cgctgcagat gattgcgggc ttcgaggccg tcagcagcgg ccgcatcgaa       240
     ctcgcgggca aggacatcac gaacgccaag gccaacacgc gcggtctggg catcgtgttc       300
     cagagctacg cgctctttcc gcacatgacg gtggccgaca acgtgagctt tggcctggag       360
     atgcgcaaga tgcccaaggc cgagcgcgcc gaccgggtga agcaggcgct ggcgctggtg       420
     cacctggagc cgcacgccac gcgctacccg cgcgagctct cgggcggcca gcggcagcgc       480
     gtggcgctcg cccgtgcatt ggtgatcgag ccgccggtgc tgctgctgga cgagccgctc       540
     tccaacctgg acgccaagct gcgcgaggag atgcagttcg agctgcgcca gatccagcgc       600
     aaggtcggca ccaccacggt gatggtcacg cacgaccaga gcgaggccat gtcgatcagc       660
     gaccgcgtgg tggtgatgga aggcggctgc gccacgcaga tcgaccatcc gcaccgcgtg       720
     tacgagcatc cgagcacgcg cttcatctcc accttcgtgg gcaaggcgaa cctgctgaac       780
     ggacgcgtga cggcctgcag caccggcagt tgcaacgtcg aggtcggccc actcgcggtg       840
     caggtcgacg aagacggctt caagtccggc gctgcggtgc tcctgagcgt gcggcccgaa       900
     aagctccagc tggtcaccgc aggccgtggc cgcctcgacg gtacggtgca ggagcgcttc       960
     ttcctcggca gccagtggct ctaccgcatc gccacgcccg caggcgacct gatggtgctg      1020
     agccccaacg acggccgcga tgcgctggac gaaggcaacg ccgtcggcat cgactggccc      1080
     gcgcactgca cgcggctctt gccggccgag gaggcggtcg cggcatga                   1128
//

If you have problems or comments...

PBIL Back to PBIL home page