(data stored in ACNUC1104 zone)

EMBL: CP002417.PE322

CP002417.PE322       Location/Qualifiers
FT   CDS_pept        complement(339250..339750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0323"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ctt:CtCNB1_3401 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34545"
FT                   /db_xref="GOA:E6V2B4"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2B4"
FT                   /inference="similar to AA sequence:KEGG:CtCNB1_3401"
FT                   /protein_id="ADU34545.1"
FT                   /translation="MKLIHALYAAIHALMALAFAIASIVLVVIAARAGWGAVMQGLGLP
FT                   TAEAIIEAVGVLAAGVVALQISQTVLEEEVLREAHISAPTRVRRFLSRFMVVIVVAVAV
FT                   EGLVATFKAREAPELMLHAATMLGAVGLLMAGWGLFIRFNRYAEELEPEAMEEAKSEDR
FT                   KLK"
     atgaagctca tccacgccct ctacgccgcg atccatgcgc tgatggcgct cgcgttcgcc        60
     atcgcctcga tcgtgctggt cgtgatcgcg gcgcgtgccg gctggggcgc cgtgatgcag       120
     ggcctgggcc ttccgacggc cgaggccatc atcgaagcgg tgggcgtgct ggcggccggc       180
     gtggtcgcgc tgcagatctc gcagaccgtg ctcgaggaag aagtgctgcg cgaggcgcac       240
     atcagcgcgc cgacccgtgt gcggcgcttt ctctcgcgct tcatggtcgt catcgtcgtg       300
     gccgtcgcgg tcgaagggct ggtcgcgacc ttcaaggcgc gcgaggcgcc cgagctgatg       360
     ctgcatgccg ccacgatgct gggtgcggtc gggctgctga tggcgggctg gggcctcttc       420
     atccgcttca accgctatgc ggaagagctg gagcccgagg cgatggaaga agccaagagc       480
     gaagaccgca agctgaagtg a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page