(data stored in ACNUC1104 zone)

EMBL: CP002417.PE323

CP002417.PE323       Location/Qualifiers
FT   CDS_pept        339978..341516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0324"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: vap:Vapar_0310
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34546"
FT                   /db_xref="GOA:E6V2B5"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2B5"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ADU34546.1"
FT                   /translation="MSEAQAILSVPTEVEQLLQRLGVPRTAYTGGELTVRSPVSGEVIA
FT                   QVPQTTAVEATGAIGRAHEAFKAWRNVPAPRRGELVRLLGEELRAAKRDLGSLVTLEAG
FT                   KIPSEGAGEVQEMIDICDFAVGLSRQLYGLTLATERAEHRMMETWHPLGVCGVISAFNF
FT                   PVAVWSWNAALALVCGDSVVWKPSEKTPLTALAVHAIAQRAIERFGDAPEGLLGLLLGQ
FT                   RDIGEVLVDDHRVPILSATGSTAMGRQVGPKLAARFARAILELGGNNAAIVTPSADLDL
FT                   TLRGIAFSAMGTAGQRCTTLRRLFVHDSVYDQLVPKLAKVYGNVQVGDPREAGTLVGPL
FT                   IDRAAFDGMQKALSESREIGAKVHGGSRVDGIGTQDAYYVRPALVELKSHDGPVLRETF
FT                   APILYVVRYSTLDEAIEWHNAVGAGLSSSIFTLNVREAERFMSSAGSDCGIANVNIGPS
FT                   GAEIGGAFGGEKETGGGREAGSDSWKAYMRRATNTINYSTALPLAQGVTFDIGD"
     atgtccgaag cccaagccat cctctctgtc cccaccgaag tcgaacaact gctgcagcgc        60
     ctgggcgtgc cccgcaccgc ctataccggc ggcgagctga cggtgcgctc gccggtcagc       120
     ggcgaggtca tcgcacaggt gccgcagacc acggccgtgg aagccaccgg cgccatcggc       180
     cgcgcgcacg aggccttcaa ggcctggcgc aatgtgccgg cgccgcgccg tggcgagctg       240
     gtgcgcttgc tcggcgaaga gctgcgcgcc gccaagcgcg acctgggtag cctcgtcacg       300
     ctggaggccg gcaagattcc gtccgaaggc gcgggcgagg tgcaggaaat gatcgacatc       360
     tgcgacttcg cggtcggcct ctcgcgccag ctctacggcc tcacgctggc caccgagcgc       420
     gccgagcacc ggatgatgga aacctggcat ccgctgggcg tgtgcggcgt gatctcggcc       480
     ttcaactttc ccgtggccgt gtggtcgtgg aatgcggcgc tcgcgctggt gtgcggcgat       540
     tcggtggtgt ggaagccgtc cgagaaaacg ccgctcaccg cactggccgt gcatgccatc       600
     gcgcagcgcg ccatcgaacg tttcggcgat gcgcctgaag gcctgctggg tctcttgctg       660
     ggccagcgcg acatcggcga agtgctggtg gacgaccacc gcgtgccgat cctctcggcc       720
     accggctcca cggcgatggg ccggcaggtc gggccgaagc tcgctgcgcg cttcgcccgt       780
     gccattcttg aactgggcgg caacaacgcc gccatcgtca cgccctcggc cgacctcgat       840
     ctcacgctgc gcggcatcgc gttctcggcg atgggcacgg ccggccagcg ctgcacgacg       900
     ctgcggcgcc tcttcgtgca cgacagcgtg tacgaccagc tcgtgcccaa gctcgcgaag       960
     gtctacggca atgtgcaggt gggcgatccg cgcgaggccg gcacgctggt cggtccgctg      1020
     atcgaccgcg cggccttcga cggcatgcag aaggcactga gcgaaagccg tgagatcggc      1080
     gccaaggtgc acggcggcag ccgtgtcgac ggcatcggca cgcaggacgc ctactacgtg      1140
     cgccccgcgc tggtggaact caagtcgcac gacggcccgg tgctgcgcga gaccttcgcg      1200
     cccatcctct acgtggtgcg ctacagcacg ctcgacgaag ccatcgaatg gcacaacgct      1260
     gtgggcgcgg gcctgtcgtc gtcgatcttc acgctcaatg tgcgcgaggc cgagcgcttc      1320
     atgtcgagcg cgggttcgga ctgcggcatc gccaacgtca acatcggccc gagcggcgcc      1380
     gaaatcggcg gcgccttcgg cggcgagaag gaaaccggcg gcgggcgcga agcaggctcg      1440
     gacagctgga aggcgtacat gcgccgcgcg accaacacca tcaattactc gaccgcactg      1500
     cccttggccc aaggcgtgac cttcgacatc ggcgactga                             1539
//

If you have problems or comments...

PBIL Back to PBIL home page