(data stored in ACNUC1104 zone)

EMBL: CP002417.PE324

CP002417.PE324       Location/Qualifiers
FT   CDS_pept        341615..342523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0325"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="KEGG: vap:Vapar_0311 extracellular solute-binding
FT                   protein family 3; PFAM: extracellular solute-binding
FT                   protein family 3; SMART: extracellular solute-binding
FT                   protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34547"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2B6"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ADU34547.1"
FT                   /translation="MKKQLKTLATAALLALAFGATATAQQAPTGGTLDKIKASGKVVLG
FT                   VREASPPMAYMLGAGEKYVGYHVELCERVLKDITPNAKLEYMAVTAQNTIPLVQNGTLD
FT                   IGCGPTTNNTARQQQVAFALTTYVSEVRMATRVDSGITTLDQLAGRNVSASTGTTAVQL
FT                   LRKRERAQNVSYNTMLGKDHLESFLLMESGRADAFVLDDNLLAGIIANSKNPAAYRIVG
FT                   DALGSEPIALLFRKDDPAFKTAVDESLRKLMKSGELEKIYTKWFVAAIPPKNTSLNLPM
FT                   SPALKQLLLEPNDKPLEAYAK"
     atgaagaagc aactgaagac cctcgccacc gcagcgctgc tcgcgctcgc gttcggcgcc        60
     acagccaccg cgcagcaggc cccgactggc ggcacgctcg acaagatcaa ggcgagcggc       120
     aaggtcgtgc tcggcgtgcg cgaagcctcg ccgccgatgg cctacatgct gggcgcgggc       180
     gagaagtacg tgggctacca cgtcgagctc tgcgagcgcg tgctgaaaga catcacgccg       240
     aatgcgaagc tcgaatacat ggcggtgacc gcgcagaaca cgattccgct ggtgcagaac       300
     ggcacgctgg acatcggctg cggccccacc accaacaaca ccgcgcgcca gcagcaggtg       360
     gcctttgcgc tcaccacgta tgtgagcgaa gtgcgcatgg cgaccagggt cgattcgggc       420
     atcaccacgc tcgaccagct cgcgggccgc aacgtgtcgg cctcgaccgg caccaccgcc       480
     gtgcagttgc tgcgcaagcg cgagcgcgcg cagaacgtct cgtacaacac gatgctcggc       540
     aaggaccatc tggagagctt cctgctgatg gagtcgggcc gcgccgatgc cttcgtgctc       600
     gacgacaacc tgcttgccgg gatcattgcg aactcgaaga acccggcggc ctaccgcatc       660
     gtgggcgatg cgctgggctc ggagccgatc gcgctcctgt tccgcaagga cgacccggcg       720
     ttcaagaccg cggtggacga gtcgctgcgc aagctcatga agagcggcga gctcgagaag       780
     atctacacca agtggttcgt ggccgcgatt ccgccgaaga acaccagcct caacctgccg       840
     atgagcccgg ccctgaagca actgctgctc gaacccaacg acaagccatt ggaagcctac       900
     gccaagtga                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page