(data stored in SCRATCH zone)

EMBL: CP002417.PE328

CP002417.PE328       Location/Qualifiers
FT   CDS_pept        complement(346714..347919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0329"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.32"
FT                   /note="TIGRFAM: amidohydrolase; KEGG: vap:Vapar_0333
FT                   amidohydrolase; PFAM: peptidase M20; peptidase dimerisation
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34551"
FT                   /db_xref="GOA:E6V2C0"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2C0"
FT                   /inference="protein motif:TFAM:TIGR01891"
FT                   /protein_id="ADU34551.1"
FT                   /translation="MKLIDSLVTQAAGIAAVRRDLHAHPELCFQEVRTADVVAGKLTEW
FT                   GIPIHRGLGTTGVVGIVKNGTSNRAVGLRADMDALPVTELNTFAHASKHHGKMHACGHD
FT                   GHTAMLLAAAQHLAKNRNFDGTVYLIFQPAEEGGGGAREMIKEGLFEQFPMDAVFGMHN
FT                   WPGMKAGQFAVSPGPVMASGNKFFVNVIGKGGHAALPQTGIDPVPIACEIVQAFQTVLT
FT                   RKMKPTDSAVISVTTIHAGEANNVIPDNCELSGTVRTFSIEVLDMIEAKMRQIAEHICA
FT                   AHDATCDFRFERYYPPTINTEAEAHFARDVMAGIVGPENVLKQEAAMTSEDFAFMLQAK
FT                   PGAYAFIGNGDGTHRDVHHGEGPCTLHNASYDFNDDLIPLGATCWVQIAEQFLNKPGGN
FT                   VS"
     atgaaactca tcgattcgct cgtcacgcag gcggccggca tcgccgccgt ccgacgtgac        60
     ctccacgccc accccgaact ctgtttccag gaagtccgca ccgccgacgt ggtggcaggc       120
     aagctcaccg aatggggcat tcccatccat cggggcctgg gcaccaccgg cgtcgtcggc       180
     atcgtcaaga acggcaccag caaccgcgcg gtcggtcttc gggccgacat ggacgccctc       240
     cccgtcaccg agctcaacac cttcgcccac gccagcaagc accacggcaa gatgcacgcc       300
     tgcggccacg acggccacac cgcgatgctg ctcgcagccg cccagcacct ggcgaagaac       360
     cgcaatttcg acggcaccgt ctacctgatc ttccagccgg ctgaagaagg cggcggcggc       420
     gcccgcgaaa tgatcaagga agggctcttc gagcagttcc cgatggacgc cgtcttcggc       480
     atgcacaact ggcccggcat gaaggccggc cagttcgccg tgagccccgg cccggtgatg       540
     gcctcgggca acaagttctt cgtgaacgtg atcggcaagg gcggccacgc cgcgctgccg       600
     cagaccggca tcgacccggt gccgatcgcc tgcgagatcg tgcaggcctt ccagaccgtg       660
     ctcacccgca agatgaagcc gaccgattcg gccgtgatct cggtcaccac catccatgcg       720
     ggcgaagcca acaacgtgat tcccgacaac tgcgagctgt cgggcacggt gcgcacattc       780
     tcgatcgagg tgctcgacat gatcgaggcc aagatgcgcc agatcgccga gcacatctgc       840
     gcggcgcacg acgcgacctg cgacttccgc ttcgagcgct actacccgcc caccatcaac       900
     accgaggccg aggcccactt cgcacgcgac gtgatggccg gcatcgtcgg ccccgagaac       960
     gtgctcaagc aagaggccgc catgacctcc gaagacttcg ccttcatgct gcaggccaag      1020
     cccggcgcct atgccttcat cggcaacggc gacggcacgc accgcgacgt gcaccacggc      1080
     gaaggcccct gcacgctgca caacgcgagc tacgacttca acgacgacct gatcccgctg      1140
     ggtgccacct gctgggtgca gatcgccgag cagttcctga acaagccggg cggcaacgtc      1200
     tcatga                                                                 1206
//

If you have problems or comments...

PBIL Back to PBIL home page