(data stored in SCRATCH zone)

EMBL: CP002417.PE329

CP002417.PE329       Location/Qualifiers
FT   CDS_pept        complement(347998..349191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0330"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: vap:Vapar_0332 glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34552"
FT                   /db_xref="GOA:E6V2C1"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2C1"
FT                   /inference="protein motif:PFAM:PF03009"
FT                   /protein_id="ADU34552.1"
FT                   /translation="MRTLQIALTATAALCVAACSGTGPSGPAKLLTLDGNPPLVIAHRG
FT                   ASGYLPEQTLEAYAKAIELGADVIEMDLVSTKDGVLIARHDPNLAISTDVAKHARFASR
FT                   KKTIKVDGETQTGWFSNDFTLAEIKTLGGISTDAERPQEFNGKFKIVTFQEIIDFAKAK
FT                   SKETGRTIAIYPETKNPTYFRDLGMPMEDKVVAAINAAGWNSKTAPIYVQSFEPGSLKY
FT                   MKAKGLNTKLIQLIDGDGIDMKTGAMTYAIPVDRPYEWTKAGDTRNFDVMVTPAGLAEI
FT                   KTYADGIGPWKRYIVTIKGSIGPDGKPLDVNKDGKVNDADATSVSPTTLIADAHKAGLF
FT                   VHPFTFRNESRRLAADYNKDGKNEYAIYYKLGVDGVFTDFTDTALAARADYLKSMGR"
     atgcgcaccc ttcagatcgc actgaccgcc accgccgccc tgtgcgttgc ggcctgcagc        60
     ggcaccggcc cctcgggccc cgccaagctg ctgacgctcg acggcaatcc gccgctggtc       120
     atcgcccacc gcggcgcctc gggctacctg ccggaacaga cgctggaggc ctatgcgaaa       180
     gccatcgaac tgggtgccga cgtgatcgag atggacctgg tctccaccaa ggacggcgtg       240
     ctcatcgccc gccacgatcc caacctggcc atcagcaccg acgtggccaa gcacgcccgc       300
     ttcgcctcgc gcaagaagac catcaaggtc gacggcgaaa cccagaccgg ctggttcagc       360
     aacgacttca cgctggccga gatcaagacg ctgggcggca tctcgaccga tgccgagcgc       420
     ccgcaggaat tcaacggcaa gttcaagatc gtgaccttcc aggagatcat cgatttcgcc       480
     aaggccaagt cgaaggaaac cggccgcacc atcgcgatct acccagaaac caagaacccg       540
     acctacttcc gcgacctcgg catgccgatg gaagacaagg ttgtcgccgc catcaacgcg       600
     gccggctgga acagcaagac cgcgccgatc tacgtgcagt cgttcgagcc cgggagcctc       660
     aagtacatga aggccaaggg cctgaacacc aagctcatcc agttgatcga cggcgacggc       720
     atcgacatga agaccggcgc catgacctat gcgattccgg tcgaccgccc ctatgaatgg       780
     accaaggccg gcgacacgcg caacttcgac gtcatggtca cgcccgcggg cctggccgag       840
     atcaagacct atgccgacgg cattggcccg tggaagcgct acatcgtgac catcaagggc       900
     agcatcggcc cggacggcaa gccgctggac gtgaacaagg acggcaaggt caacgacgcc       960
     gacgccacct cggtctcgcc caccacgctg atcgccgacg cccacaaggc gggtctcttc      1020
     gtgcacccct tcaccttccg caacgagtcg cgccgcctgg ctgcggacta caacaaggac      1080
     ggcaagaacg agtacgcgat ttattacaag ctcggcgtgg acggcgtttt caccgacttc      1140
     accgataccg cgctggctgc gcgggccgac tatctgaaga gcatggggcg ctga            1194
//

If you have problems or comments...

PBIL Back to PBIL home page