(data stored in ACNUC1104 zone)

EMBL: CP002417.PE33

CP002417.PE33        Location/Qualifiers
FT   CDS_pept        35575..37827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0033"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="KEGG: vap:Vapar_0031 heavy metal translocating
FT                   P-type ATPase; TIGRFAM: heavy metal translocating P-type
FT                   ATPase; copper-translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase-associated domain protein; Heavy metal
FT                   transport/detoxification protein; Haloacid dehalogenase
FT                   domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34256"
FT                   /db_xref="GOA:E6UXR2"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXR2"
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /protein_id="ADU34256.1"
FT                   /translation="METLQQHPSAATANATTLDLSVGGMTCASCVMRVERALKNVPGVQ
FT                   AVSVNLATESARVVTTDAEDMDARLRRAVRAAGYEPRAASSAADEAAALSPWHGVGPVA
FT                   IGLALSIPLLAPMLGDPFGQDWMLPPWLQLLLAAPVQFWLGARFYRAGWHAAKARTGNM
FT                   DLLVALGTSAAFGLSLWLWWRSATGEHAGHGEMPHLYFEAAAVVITLVLLGKWLEARAK
FT                   RQATSAIRALQQLRPEVAHLVGARGESDVPLAEVMVGDRLAVRPGERVPADARVIEGQS
FT                   EVDESMLTGEPLPVAKGPGDALTGGAVNGDGRMVIEVSAIGAESVLARIIRLVEDAQAA
FT                   KAPIQRLVDKVAAVFVPVVLVIALLTLAGWLIAGAGIETALIYAVAVLVIACPCALGLA
FT                   TPVAVMAGTGVAARHGILIKDARSLEIAHRVDTVAFDKTGTLTLGRPVLTALLPVASIE
FT                   ATENQLLATAASLQGGSEHPLARAVLAAAVQRGVQAPPLGAMQAMPGRGVRGEVNGATW
FT                   AIASLRWCRELDAMPAEAEVESLQAQGATVSALLRFDEAGAAHVQALLAFADEPKPQAA
FT                   EAIRTLRARGLRVVMISGDNLRAAQAMAARLGIAIEDVRADVLPADKAAQVSALRRDGH
FT                   VVAMVGDGANDAPALAAADVGIAMAPSGGGTDVAMEAAGITLMRGDLALVAQAFELSAR
FT                   TVAKIRQNLFWAFAYNVAGIPLAAFGLLSPVVAGAAMALSSVSVMANALLLRRWKP"
     atggaaacct tgcagcaaca tccttcggcc gccactgcca acgccaccac gctggacctc        60
     tcggtcggcg gcatgacctg cgcttcgtgc gtcatgcgcg tggagcgcgc cttgaagaac       120
     gtgcccggcg tgcaggccgt cagcgtgaac ctcgcgaccg agtcggcccg cgtggtgacc       180
     accgatgccg aagacatgga cgcgcgcttg cgccgcgccg tgcgggctgc gggctacgaa       240
     ccgcgtgccg caagcagcgc ggccgacgaa gcggccgcac tgtcaccgtg gcacggcgtc       300
     ggtccggtgg ccatcggcct cgcactgtcg attccgctgc tggcacccat gctcggcgac       360
     cccttcgggc aagactggat gctgccgccc tggctgcaat tgctgctggc ggcaccggtt       420
     cagttctggc tcggtgcgcg gttctatcgc gcgggctggc acgcagcgaa ggcccgcacc       480
     ggcaacatgg acctgctggt ggcgctcggc accagcgcag cgttcggcct gtccctgtgg       540
     ctgtggtggc gctcggcgac gggtgagcac gcgggtcatg gcgaaatgcc gcacctgtac       600
     ttcgaagcag ccgccgtggt gatcacgctg gtgctgctcg gcaagtggct cgaggcgcgt       660
     gccaagcgcc aggcgacctc cgcgattcgg gcgctgcagc aactgcggcc cgaggtcgcg       720
     cacctggtcg gcgcgcgcgg tgaaagcgat gtgccgctcg ccgaggtgat ggtgggcgac       780
     cgcctcgccg ttcgtcccgg cgaacgcgtg ccggccgatg cgcgcgtgat cgaaggacag       840
     tccgaagtcg acgaatcgat gctcaccggc gaaccgctgc cagtggccaa gggacccggc       900
     gatgcattga cgggcggcgc ggtcaacggc gatggccgga tggtgatcga ggtgagcgcg       960
     atcggtgccg agagcgtgct ggcgcggatc atccgtctgg tcgaggacgc acaggctgcc      1020
     aaggcgccga tccagcggct ggtggacaag gtggcggccg tgttcgtgcc cgtggtgctg      1080
     gtgattgcgc tactcacgct ggcgggttgg ctgatcgccg gtgccggcat cgaaaccgcg      1140
     ctgatctacg ccgtcgctgt gctggtgatc gcgtgtccct gtgcgctggg cctcgccacg      1200
     ccggtcgcgg tgatggccgg caccggcgtg gccgcgcggc acggcatcct gatcaaggac      1260
     gcgcgttcgc tggagatcgc gcaccgcgtc gacaccgtgg ccttcgacaa gaccggcacg      1320
     ctgactctgg gccggcccgt gcttaccgcg ttgctgccgg tggcaagcat cgaggccacg      1380
     gaaaaccagc tgctcgccac cgccgccagt cttcaaggcg gcagcgaaca cccgctcgca      1440
     cgcgccgtgc tcgcggccgc agtgcaacgc ggcgtgcagg cgccgcccct gggcgcgatg      1500
     caggccatgc cgggccgtgg tgttcgcggc gaagtgaacg gtgccacctg ggccatcgcg      1560
     agcctgcgct ggtgccggga gctcgatgcg atgcccgcgg aagccgaggt cgagagcctg      1620
     caggcgcaag gcgccacggt gtcggcgctg ttgcgtttcg acgaagcagg cgccgcgcat      1680
     gtgcaggcct tgctggcctt cgccgacgaa cccaagccgc aggccgctga agccattcgc      1740
     acgctgcgtg cgcgaggctt gcgcgtggtg atgatctcgg gcgacaacct gcgcgcggcg      1800
     caagccatgg cggcgcggct cggcattgcg atcgaggatg tgcgtgccga tgtgttgccg      1860
     gccgacaagg ccgcgcaggt cagcgcgttg cgtcgcgacg gccatgtcgt ggcgatggtc      1920
     ggcgatggcg cgaacgacgc gcccgcgctc gccgcggccg acgtgggcat cgcgatggcg      1980
     ccctcgggcg gcggcaccga cgtggcgatg gaagcggccg gcatcacgct gatgcgcggc      2040
     gacctcgcgc tggtggcgca ggcgttcgaa ctgtctgccc gcacggtcgc gaagatccgg      2100
     caaaacctgt tctgggcctt tgcctacaac gtggccggca tcccgctcgc ggccttcggc      2160
     ttgctgagcc cggtagtcgc aggtgccgcg atggcgctgt cgagcgttag cgtgatggcg      2220
     aatgcgttgc tgttgcgccg atggaagccc tga                                   2253
//

If you have problems or comments...

PBIL Back to PBIL home page